KEGG   Fomitiporia mediterranea: FOMMEDRAFT_75740Help
Entry
FOMMEDRAFT_75740  CDS       T03132                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00010  Glycolysis / Gluconeogenesis
fme00030  Pentose phosphate pathway
fme00051  Fructose and mannose metabolism
fme00052  Galactose metabolism
fme00680  Methane metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
fme01230  Biosynthesis of amino acids
fme03018  RNA degradation
Module
fme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FOMMEDRAFT_75740
   00030 Pentose phosphate pathway
    FOMMEDRAFT_75740
   00051 Fructose and mannose metabolism
    FOMMEDRAFT_75740
   00052 Galactose metabolism
    FOMMEDRAFT_75740
  09102 Energy metabolism
   00680 Methane metabolism
    FOMMEDRAFT_75740
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FOMMEDRAFT_75740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fme01009]
    FOMMEDRAFT_75740
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fme03019]
    FOMMEDRAFT_75740
Enzymes [BR:fme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FOMMEDRAFT_75740
Protein phosphatases and associated proteins [BR:fme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FOMMEDRAFT_75740
Messenger RNA biogenesis [BR:fme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FOMMEDRAFT_75740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 18679708
NCBI-ProteinID: XP_007262730
JGI: Fomme1_75740
LinkDB All DBs
Position
Unknown
AA seq 825 aa AA seqDB search
MSRVKQKIAVLTSGGDSAGMNAVVRAVVKYGIIRGCETYVVREGYEGLVRGNLDAPKRKV
VFNSANNAVDTADLVDDKLINNLRFGDGRLLREGEGDAIDRPGGRSLKGRYIIRVGWDDV
RGWFAEGGTLIGTARSQAFRTREGRLAAALNLITEGIDSLVVCGGDGSLTGADVFRSEWP
SFVTELRTSNQITEEQAQRHAHLKIVGTVGSIDNDMSMTDITIGAFTALHRICEAIDNIN
TTAFSHSRAFVVEVMGRHCGWLALMAGVSAGADFIFIPERPPQADPWEDDMCKSIQSHRE
VGKRKTIVIVAEGAHDANLNPIRAEYVKEVLTERLGLDTRVTCLGHTQRGGRPCAYDRIL
PTMQGVEAVDALLEATPDTPSYMIGIHENKIHRVPLMEAVAQTRAVATAIGEKDFEKAMS
YRDPEFCEALEGFVAVSALDFSRKLPKDQRMRVAIIHMGAPAGGMNAATRAATRYCLRRG
HKPLAIYNGFRGLLDDNIEELSWLRVDNWMTRGGSELGTNRTLPDIDLGAVASQFQKHRF
DAFFLIGGFEAFRSLQILDAARSLYPAFHIPMVCVPATISNNVPVTEFSLGSDTSLNALV
DACDAIKQSASASRNRVFVVETQGGKCGYIATMGALAVGAVCFYTPEDGITLDGLRKDVE
FLKLRYSLDEKGKAEGRIIMRNEQASNVFTTDFIQKMLQEEGGALFDSRLASLGHTLQGG
IPSPMDRARAVRLSLKCMAFLEHHHDSIRSQPELKRKAPDGSAAVITIQSSNVEFTPVKD
MIAHADMKNRRGKSSWWEELKPMVAMLGGRTALVDDGNGDGKTKG
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtccagagttaagcaaaagatcgctgtgctgacgtccggtggcgacagtgctggcatg
aacgctgtcgtgcgtgccgttgttaaatatgggattattcggggttgcgagacgtacgtc
gtcagagaaggatacgaaggccttgtccgtggcaacctcgatgcaccgaaacgcaaggtc
gttttcaattcagccaataacgctgttgatacagcagatcttgtcgacgacaagctcatc
aacaaccttcggtttggtgatggtcgtttgctcagagaaggagaaggagatgctattgac
cgtccgggaggcagaagcttaaagggtcgctatatcattcgagttggatgggacgatgtt
cgtggctggtttgctgagggtggaaccctgatcggtactgcacgttcacaagcgttccgc
acgagagaaggacgcttggccgcagcgctcaacctaatcaccgaaggcatcgactcacta
gttgtatgcggtggcgacggctctctcaccggtgcagacgtcttcagatccgaatggccc
agcttcgtcaccgagcttcgcacatccaaccaaataacagaggaacaagcccaacgacac
gctcacttaaagatcgtcggtacagtcggctcaattgacaacgacatgtccatgacggac
atcactatcggtgctttcaccgcacttcatcgtatttgcgaggcgattgataacattaat
accacggcattttcgcattctcgtgcgtttgttgtggaagttatgggccgccactgtggg
tggcttgcgttgatggcgggtgtgagcgctggtgcggattttatttttattcctgagagg
ccgccacaggcggacccttgggaggatgatatgtgcaagagtattcagagtcaccgagaa
gttggtaaacgcaagacaatcgtaatcgtcgcagaaggcgctcacgacgcgaacctcaac
cccattcgcgcggagtacgtcaaggaagtgttgactgaaaggttggggctcgatacccga
gttacctgcttggggcacactcaacgcggtggacggccctgtgcgtatgatcgtattctg
ccaactatgcaaggtgttgaagcggtagatgcgcttcttgaggcgaccccggatacacct
tcgtatatgattggaattcatgagaataagattcatcgtgttccgttgatggaggccgtt
gctcagactcgagctgtcgcgactgctatcggcgagaaggacttcgaaaaggcgatgtcc
tatcgcgatcctgaattctgtgaggctctggaaggctttgtagctgtctctgctctcgac
ttctctaggaagctgccaaaggatcagagaatgcgtgtagcaatcatacatatgggtgcc
ccagcaggtggaatgaacgccgcaacccgtgcagctacacgctactgtctccgtcggggc
cacaaaccactcgcaatctacaacggtttccgaggtctcctcgacgacaacatcgaagaa
ctctcctggctacgcgtcgacaactggatgacgcggggtggttccgaactcggaacaaac
cgtacactaccagacatcgacctcggagccgtagcttcacaattccaaaaacatcgattc
gacgcgttcttccttattggtgggttcgaagcttttcgctccttacaaattcttgatgca
gcgaggtctctgtacccggcgttccatattccgatggtttgtgtacctgcgacgataagc
aataacgtacctgttacggagtttagtttggggagtgatacgagtttgaacgcgcttgtg
gatgcttgtgatgcgatcaagcagagtgcgagtgccagtaggaatagggtttttgtggtt
gagactcagggtgggaagtgtgggtatattgctactatgggtgcgcttgctgttggtgcg
gtctgtttctacacgcctgaagacgggattacgcttgatggactgcgaaaggacgtcgag
ttcttgaagctccggtacagcctcgacgagaaagggaaagcagagggtcggattatcatg
aggaacgaacaagcctcaaacgtcttcacaaccgacttcatccaaaaaatgctccaagaa
gaaggcggagcactcttcgactcccgtctcgcctcattgggacacaccctccaaggcggc
atcccctccccaatggaccgcgcccgtgccgtccgactctccctaaaatgcatggctttc
ctcgaacatcaccacgactccattcgttctcagccagagttgaagaggaaagcaccagat
ggaagtgcagcagtgattacgattcagagttctaatgtcgagtttacacctgtgaaggat
atgattgcacatgcggatatgaagaatagacgagggaagagttcgtggtgggaggagttg
aagcctatggttgctatgcttgggggacggactgcgcttgttgatgatggaaatggagat
gggaagacgaagggttaa

DBGET integrated database retrieval system