KEGG   Fomitiporia mediterranea: FOMMEDRAFT_81600Help
Entry
FOMMEDRAFT_81600  CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fme  Fomitiporia mediterranea
Brite
KEGG Orthology (KO) [BR:fme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fme03036]
    FOMMEDRAFT_81600
Enzymes [BR:fme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FOMMEDRAFT_81600
Chromosome and associated proteins [BR:fme03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FOMMEDRAFT_81600
   HDAC complexes
    Sin3A-HDAC complex
     FOMMEDRAFT_81600
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    FOMMEDRAFT_81600
  Chromatin remodeling factors
   NuRD complex
    FOMMEDRAFT_81600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18680031
NCBI-ProteinID: XP_007265905
JGI: Fomme1_81600
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MVPIDGEPKKRVCYFFDPDVGGFHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIFRAKPA
TEREMTQFHSDEYVKFLKRVTPANMSSFVKEQHKYNVGDDCPVFDGLFDYCSISAGGSME
GAARLSRDKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRYHNRVLYIDIDVHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGEVRDIGIGRGRGHSVNFPLRDGITNENYKA
IFEPVINEVMRVYDPGAIVLQCGTDSLSGDKLGCFNLSMRGHANCVKFVKSFNKPLLMLG
GGGYTMRNVSRAWAYETGLAAGVELGSEIPVNEYYEYFGPDYKLDVRSSNMEDLNTSAYL
NRVKSIVMENLRSLGGPPSVQMMDIPRLPIDDVLDDPSRDEDTVNPDKRRPMRLLDSLVQ
RDDEFSDSEDEGEGGRKNHARHRDADSAVSPSRRFGVGVGIMGAAPPGLGSAAAAVAGGV
PIGVGGVGSGGPSAHIAVESLVKRKGEDEDEVTEVPMDDESLQADVVMDDADENAESAAA
TSNKSITPPQEMEIEDTPPPPPPVTTVSGGTTSEANHSSSKAPERAPSEAQS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggtacctattgatggcgaacccaagaaacgcgtctgttatttcttcgacccagatgtt
ggagggtttcattatggtcctggacatccgatgaagccgacaaggatacgaatgtgtcat
tctcttgttatgaactatgggttgtataagaagatggagattttccgcgcaaagccagcc
acggaacgcgaaatgacacagttccattcggacgaatacgtcaagtttttgaagcgcgtt
acccctgcgaatatgagttcctttgttaaagaacagcataaatataacgtaggagacgac
tgtcctgtgtttgatgggttgtttgattactgttcgatctcggctggtggttctatggag
ggtgcggcgcgtctaagtcgggataaatgtgatatcgctgtgaactgggcgggcgggtta
catcatgcaaaaaagagcgaagcgagtgggttttgttatgttaatgatatcgtgttggga
atcctcgagttattaagataccacaatcgcgtactatacatcgacatcgatgtacaccat
ggcgacggtgtcgaagaagcattctacacaacagaccgcgtcatgaccgtcagtttccac
aagtacggtgaatacttccctgggacgggtgaagttcgggatattggtattgggagagga
cgaggtcactcggtgaattttccgttgcgagatgggattacgaacgagaattataaggcg
attttcgagccggtcatcaacgaagtgatgcgtgtgtatgatcctggtgcgatcgtacta
caatgtggaacggactcgctttctggtgacaagcttgggtgcttcaacttatccatgcga
gggcacgcaaactgcgtaaagttcgtcaaatcattcaacaagcctttgctcatgcttggt
ggaggcgggtatacgatgcgaaacgttagtcgagcttgggcgtacgaaaccggtcttgca
gcaggcgtggagcttggaagcgaaattcctgttaacgagtactatgagtatttcggtccg
gactacaaacttgacgtgcggtcgtcaaatatggaagacttgaacacttccgcgtacttg
aaccgcgtcaagagtatcgtgatggaaaatctcagatcattgggcggaccacccagcgtt
cagatgatggacataccgcgactccctattgacgacgtacttgatgatccaagtcgagac
gaggacacggtaaatcctgacaagcgccgaccaatgcggttactggatagtcttgtacag
agggatgacgagttctcagattcggaggacgaaggtgagggcggacggaagaaccacgcg
cggcatcgcgatgcggatagcgccgtctcgcccagtcgacgcttcggagtcggtgttggc
atcatgggtgctgctcctcctggtctaggctccgcagcggcggctgttgccggtggcgta
ccaattggtgtgggtggtgtaggtagtggtggtcctagcgcgcatatagctgtggaatct
ctcgtaaaacgcaagggcgaggacgaagatgaggtaaccgaggtaccgatggatgatgag
tcgctccaggcagatgtggtgatggatgatgcggatgaaaatgcagagtcggcagcagcg
actagcaataaatctattacgcctcctcaggagatggagattgaagacactccgccaccc
ccaccgcctgtgactactgtgtcaggtggcacgaccagcgaggcgaatcattcgtcttca
aaagcaccagagcgtgcaccttcggaggcgcagtcatag

DBGET integrated database retrieval system