KEGG   Fomitiporia mediterranea: FOMMEDRAFT_85868Help
Entry
FOMMEDRAFT_85868  CDS       T03132                                 

Definition
(RefSeq) RNA methylase
  KO
K15430  tRNA (guanine10-N2)-methyltransferase [EC:2.1.1.214]
Organism
fme  Fomitiporia mediterranea
Brite
KEGG Orthology (KO) [BR:fme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fme03016]
    FOMMEDRAFT_85868
Enzymes [BR:fme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.214  tRNA (guanine10-N2)-methyltransferase
     FOMMEDRAFT_85868
Transfer RNA biogenesis [BR:fme03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    FOMMEDRAFT_85868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0020
Motif
Other DBs
NCBI-GeneID: 18680294
NCBI-ProteinID: XP_007267067
JGI: Fomme1_85868
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MPIRCIVHFAQVHSEFRLPELESIAELYDFRFSRPAPGSLQDSSSEDWDPMRPFWVMDFE
REEHARYLAERCILVKSVYELYGRGSSYESVYAQTRENKHLWVPYAENTSFRFTVMGYNY
SIPLRRVKEIVESFRFMDFRGPIDLKNPELTLSVFEEYADRGTATVRNRHGGDGEFSQIY
FGRLVAEGKARALVGKFDVKKRAYFGNTSMEAEISLLMANQTLASPGKFIYDPFIGTGSM
AYTVAHFGALVFGSDIDGRQMRGKYDEPGILRAAAQYGVANRVLDLCTFDITRNPLRCGG
LFDAIITDPPYGVRAGAKRLGRKPTDKKADRERKPEYDEAQRKGLIEYVPPKHAYELSEL
VSDLVQFARYLLRPNGRLVFFLPTVTDEYAEVDVYSMLCEGMEVVANSVQSFGSWGRRLI
TIKKTTGTYYPSPFETSKEGKDRVSVSAPDRTGNGGHVPAHKDFREKYFKGFRRDTDENE
PGMPQVGQLTEQNGGRSG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccgatgcattgtgcatttcgcacaggtacactcggagtttcgtctccccgaa
ctggaatcaattgccgagctctatgatttccgattttctcgacctgctccaggctcgctg
caagacagctcatcagaagattgggatccgatgagacctttttgggtgatggatttcgaa
agagaagaacatgctagatacttagcggagcgatgtatccttgtcaagtccgtatatgaa
ttatacggccgtggctcatcatatgagtcggtatatgcgcaaacacgcgagaacaagcat
ttatgggtgccctacgccgaaaatacatcgttccggtttaccgtaatggggtacaactac
agtattccgctccggcgtgtcaaggaaattgtagaaagcttcagattcatggacttccga
ggaccaattgatttgaagaatccggaacttactctatctgtcttcgaggagtatgcggat
cgcggcacagctactgtccgcaatagacatggaggggatggagagttttcacagatctat
tttggaaggttggtggcagaaggcaaggcacgagctctagtgggaaaattcgacgtaaag
aagcgcgcttactttggaaacacgtctatggaagctgagatctccttgctcatggcgaat
caaacgctggcatcacctggaaaattcatttatgatccttttattggaacgggaagcatg
gcttatacggttgcgcactttggagcgcttgtgtttggttcggacattgatggccggcaa
atgcgtggaaagtatgatgaaccgggtatattacgtgctgcggcgcaatatggcgttgct
aatcgagtcttggacctgtgcactttcgatatcacgaggaatccattacggtgtggcggt
cttttcgacgccattatcactgatccaccatacggtgtgcgcgcaggtgcgaaacgtcta
ggtaggaaaccgaccgacaagaaagccgatcgtgagcgcaagcccgaatacgacgaagcg
cagagaaaagggctcatagaatacgttcctccgaagcatgcatacgaactgtctgagcta
gtgtcagatctcgtacagttcgctcgatatctgttacgtccaaatggacgactcgtattt
ttcttgcccacagtcacggatgaatatgcagaagtcgatgtgtacagcatgctctgcgaa
ggaatggaggttgttgctaattcagtgcagagcttcggttcctggggaagaagattgata
acaatcaagaaaacaacgggtacttattacccttccccatttgagacatcaaaggaagga
aaagatcgtgtttctgtttccgcgccagaccgaactggaaatggtgggcatgttccagca
cacaaagacttccgagagaagtacttcaaagggtttcggcgagatacagacgaaaatgaa
cctgggatgccacaggtggggcaattgacggaacaaaatggcggcagaagcggctga

DBGET integrated database retrieval system