KEGG   Fomitiporia mediterranea: FOMMEDRAFT_87257Help
Entry
FOMMEDRAFT_87257  CDS       T03132                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_87257
Enzymes [BR:fme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FOMMEDRAFT_87257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 18680361
NCBI-ProteinID: XP_007267519
JGI: Fomme1_87257
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MFPFTQLSLSLISLLLLQYLPSAYTANADAWRTRSIYQIIVDRYALPKGADTTACDPAQQ
TWCGGTWNTIRENLDYIQDAGFTAIWISPVSKNYEGPRTPYGDPYHGYWISDASQLNDKF
GTADDLKGLSDDLHKRGMYLMVDVVVNNVMSLSNTSMDYQSFLFKEPQYYHPYCPVDFSN
DTSVQMCWLGDTNVYLPDVKTEDPFVVSTYNSWIQQLVQEFNIDGLRIDAAKHVNNGFWP
GFCSSAGVFCIGEVFDADPAQASQYQGPTALDSILHYPMYNALTAAFTIPGTQNMSAMPD
MISRSASLFKDPTLLGNFLENQDVPRWGNLSVDPQSMYNAMTFTFMSDGIPIVYYGQEQG
FHGSSDPFNREPLWPSGYANTTSYQLVSTLNQFRNFLVNTSDFATQPMKVLASNDAALAI
NKGNVISVVTNVGSPVRALHAHIVVAFVATRILECRQVAVGSGGAMLVDYSKGGKPMVFF
QESMMSGTGLCGYPGSNKSTLAGLGSSSAAVQSVRWGPLAVGLAVGSLGSLLLF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttccctttcacacaactctcgctttcgttgatctctcttttgctcctccaatatctc
ccctcagcatacactgccaatgccgacgcttggcgaacccgctcaatctaccagatcatt
gttgaccgctatgcgcttcctaaaggtgctgacacgaccgcctgtgatcctgcacagcag
acctggtgtggtgggacttggaatacaatccgagaaaatctcgactatatccaggacgcc
ggattcaccgccatttggatcagccctgtatcaaagaactatgagggcccgcgcacccca
tacggcgatccataccatggctactggatttctgacgcgtcccagctcaacgacaaattc
ggtaccgcagatgacctcaaaggcctgtctgatgatttgcacaagcgcggcatgtatctc
atggttgatgtcgttgtgaacaacgtcatgtcacttagcaacacgagcatggattaccag
tccttcctcttcaaagaacctcaatactaccatccttattgccccgtcgactttagtaac
gatacaagtgtgcagatgtgctggcttggcgacactaacgtctacctcccggatgtgaag
actgaggatcctttcgttgtgtcgacatacaacagctggatccagcaacttgtccaggag
tttaatattgacggtttgcggattgacgcggctaagcacgtcaataacggtttctggcca
ggcttctgctcaagtgcgggtgtcttctgtattggcgaagtcttcgatgccgatcctgcc
caagcttctcaataccaaggtccaactgcactcgactccattttgcactatcctatgtac
aacgctcttactgcagcattcactattcccggtacccagaatatgagtgcaatgccggac
atgatttcacggtctgcgtcactctttaaggatccaacgcttctgggaaacttcctggag
aaccaagatgtacctagatggggtaacctgagcgtggatcctcagagcatgtacaacgca
atgaccttcaccttcatgtcggatggaatccctatcgtttactatgggcaagagcagggc
ttccatggctcttcggatccttttaaccgtgagcctctctggccgtctggttatgccaat
acgaccagttaccagttggtctctaccttgaatcagttccgtaacttcctcgtgaatacg
tccgactttgcgacacagccgatgaaggttttggcttcgaatgatgctgctcttgcgatt
aacaagggcaatgtcatttccgtcgtcactaatgtcgggtcacctgtgcgtgcattacac
gctcatatcgtcgttgccttcgtcgccaccagaattctggaatgcagacaagttgctgtc
ggaagtggcggcgctatgctagttgactactccaagggaggaaagccaatggtcttcttc
caggagagcatgatgagtgggactggtctctgtggctacccaggctcaaacaagtcaacg
ctcgcaggacttgggagctcgtctgctgctgttcagtcggtcagatggggccctttagca
gtcggattagcagttgggagtttaggatctctgcttctcttttaa

DBGET integrated database retrieval system