KEGG   Fomitiporia mediterranea: FOMMEDRAFT_89129Help
Entry
FOMMEDRAFT_89129  CDS       T03132                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_89129
Enzymes [BR:fme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FOMMEDRAFT_89129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18680472
NCBI-ProteinID: XP_007268446
JGI: Fomme1_89129
LinkDB All DBs
Position
Unknown
AA seq 576 aa AA seqDB search
MISALVVLLAYLWTSFAQTAVDSYVATESPIAKTNLLANIGASGSKSQGAKPGIVIASPS
TTNPNYLFTWTRDSSLVFKTIIDQYTNGQDTSLRTLIDEFVSAEATLQQVSNPSGTVSTG
GLGEPKFNIDETAFTGAWGRPQRDGPALRATAIINYANYLLANDNSSFVTNTLWPILQLD
LDYVAQDWNQTTFDLWEEVDSTSFFTAAVQHRSLREGATLATKIGQTSVVSGYTTQAENI
LCFMQSFWNAGGNFMTANTGGGRSGKDANTVLASIHTFDSSAGCDAATFQPCSDRALANL
KTYVDAFRSIYSINSGIASNAAVATGRYPEDVYFNGNPWYLTTLSVAEQLYDAITVWNAQ
GSLNVTSVSQPFFALFQSDIAVGTYASSSSTFTSLLSSIKSFADGFVSVVAKYTPSNGGL
SEQYSKSDGTPTSAVDLTWSYAAALTAFAARDGFVPASWGAAGLTVPSTCSTSGSGPGSG
GTVAVTFNVQATTVFGENIYITGSVDALQNWSPDNAIILSAANYPTWSVTINLPASTTIQ
YKYIRKFNGAVTWESDPNMQITTPSGGTFIENDVWR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgccctcgtggtcctgcttgcgtatttatggacgtcgtttgcgcagacggca
gtagactcttatgttgcgactgagagtccgattgcgaaaaccaacctattggccaatatt
ggagcatctgggtcgaaatctcagggagcgaaaccgggaatcgtgattgcgtctccgagt
accaccaatccgaattatttgttcacctggactcgggactcgtctcttgttttcaagact
attattgaccagtatacgaatgggcaagatacatctttaaggacacttatcgacgagttc
gtttccgccgaggctaccctgcaacaggtatcaaatccatctggaacggtgtctaccggt
ggccttggagagcctaagttcaatattgacgaaactgcttttacgggtgcatggggacgt
ccccagcgagacggaccagctttgcgtgcgactgccatcataaattatgctaactatttg
cttgcgaatgacaactcatcgtttgttactaacaccctttggcctatacttcaactcgac
ttggactacgttgctcaggattggaaccaaaccaccttcgatctttgggaggaagttgat
tctacgtctttctttaccgccgctgtacagcatcggtctctccgggaaggtgctacgctt
gctacgaaaataggtcagactagtgttgtttcgggatacacgacgcaagcggagaatatt
ctgtgcttcatgcagtcgttttggaatgctggagggaacttcatgactgcaaacacagga
ggaggccgctctggaaaagatgccaacacggttctcgcgtccattcatacgtttgactcg
agtgctggatgcgacgcggcaacgttccagccgtgctcggacagagctctagcaaatttg
aagacatatgtagacgcattcagaagtatctactcgatcaactctggaatagcgtccaac
gcagccgttgccactggccgctatccagaggatgtgtacttcaacggaaatccctggtat
ctaacaactctctctgttgccgagcagctctacgacgcaatcaccgtctggaatgcccaa
ggctcactaaacgttacatccgtttcacaacctttcttcgccctcttccaatccgacatc
gctgtcggcacatatgcgtcgtcctcttcaacgtttacgtccctcctttcatccatcaag
agcttcgcagacggcttcgtctccgtcgttgcaaagtacactccaagcaacggcggttta
tccgaacagtactcgaagagtgacggaacgcctacgagtgcagttgaccttacgtggagt
tacgctgctgcgttaacggcgttcgctgctcgcgatggattcgtaccagctagctgggga
gctgctggcttgacggtaccttcgacgtgctctactagtgggtcgggacctggttcgggt
ggtactgtcgctgtaacgtttaacgttcaggcgaccactgtgtttggagaaaacatttat
atcaccggctctgtcgatgcgctacagaactggtcaccagacaacgcgatcatcttgagt
gctgctaactatcctacctggagtgtgacgatcaacctcccagcgagcacgactatacag
tacaaatacattcgaaagttcaacggtgctgtgacttgggaatcggacccaaatatgcag
atcacgacgccttcaggcgggacgtttatcgagaacgacgtttggcgctaa

DBGET integrated database retrieval system