KEGG   Fuerstia marisgermanicae: Fuma_01034Help
Entry
Fuma_01034        CDS       T04678                                 

Gene name
ddlB_1
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fmr  Fuerstia marisgermanicae
Pathway
fmr00550  Peptidoglycan biosynthesis
fmr01100  Metabolic pathways
fmr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Fuma_01034 (ddlB_1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fuma_01034 (ddlB_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Fuma_01034 (ddlB_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fmr01011]
    Fuma_01034 (ddlB_1)
Enzymes [BR:fmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Fuma_01034 (ddlB_1)
Peptidoglycan biosynthesis and degradation proteins [BR:fmr01011]
 Precursor biosynthesis
  Amino acid ligase
   Fuma_01034 (ddlB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: APZ91446
UniProt: A0A1P8WBM9
LinkDB All DBs
Position
1385770..1386795
Genome map
AA seq 341 aa AA seqDB search
MRKLRVAALIRDGLVPPDEATGYDVNNPPDWKMEFDIIATLREMGHDVRPIGLYDDLTPV
RDSILNWKPHVAFMMLEEFHGVAQYDHAIVSYLELMKQQYTGCNARGLMLSHDKALSKKI
LNYHRVPTPGFAVFRRRRKIRPPAKLKYPILVKSATEDASFGISQKSIVHNDAALIERVK
FVHEHVGSDALVEEYIEGRELYVGVMGNKQLSVFPVWEMFFRNMPDDVAHIATARVKWNT
RYQKKHGIETGRAPDLTDEQTAKIQHICKRVYRALNMSGYGRIDIRMNAAGQVYVIEANA
NPNLEFGEDFAESAEADGISYEQLLTRVVNLGLKYDAAWRQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacttcgtgtggcggccctcattcgggacggtcttgtgccgccggacgaagcg
acgggttacgatgttaacaatcctcccgactggaagatggaattcgacatcatcgccaca
ctgcgcgaaatgggacacgacgtccggcccatcggtctatacgacgatctgactccagtt
cgcgattccattctcaactggaagccacacgtagccttcatgatgctggaggaatttcac
ggggtcgctcagtacgaccacgccatcgtcagctatcttgagttaatgaagcagcagtac
actggctgcaacgcgcgcggcctgatgctttcgcacgacaaagctttaagcaagaagatc
ctgaactaccaccgcgttccaacgcctggcttcgcagtctttcgtcgccgtcgcaaaatt
cgaccgccagcgaaattgaagtacccgattctcgtcaagtcggctacggaagacgcatcg
tttgggatttctcaaaaatctatcgtccacaacgacgccgcattaattgaacgagtgaaa
tttgttcacgaacacgtcggctctgacgctttggttgaagaatacatcgaaggccgcgaa
ctgtacgttggtgtgatgggcaacaaacagttgagcgtctttccggtgtgggaaatgttc
ttccgcaacatgccggacgacgtggcacatattgccacggcgcgagtgaagtggaatact
cgataccaaaaaaagcacggcatcgaaaccgggcgagcacccgatctgacggacgaacag
acagcgaagattcagcacatctgcaaacgcgtataccgagcgttgaacatgagtggctat
gggcggatcgacattcgcatgaacgctgccgggcaggtctatgtgatagaagccaacgcg
aatcccaacctggaattcggcgaagactttgcggagtccgccgaagctgacggcatctcg
tacgaacagttgctgactcgcgtggttaaccttggcctgaagtacgacgcagcctggcgg
cagtag

DBGET integrated database retrieval system