KEGG   Fuerstia marisgermanicae: Fuma_01887
Entry
Fuma_01887        CDS       T04678                                 

Definition
(GenBank) putative DNA modification/repair radical SAM protein
Organism
fmr  Fuerstia marisgermanicae
SSDB
Motif
Pfam: Radical_SAM HHH_3 HHH_5 HHH Fer4_12
Other DBs
NCBI-ProteinID: APZ92277
UniProt: A0A1P8WE24
LinkDB
Position
complement(2499154..2500464)
AA seq 436 aa
MDGTTTDEWPPKKKQLTMSQDVQTKLKILADAAKYDASCASSGSKGTRQGSKLGSTEGMG
ICHSYTPDGRCVSLLKILMTNYCIYDCQYCVNRVSSDTPRARFTTDEIVDLTIQFYQRNY
IEGLFLSSGIIQSPDYTMEQMNLVAMTLRTKHRFGGYIHLKSIPGASDDLLADAGRWADR
LSVNVELPTAGDLQQLAPEKKEPEITHAMGTIKGRIDEFKTEKKAGFKVPKFAPAGQSTQ
MIVGATPTPDLEILQTASSLYNNHDLRRVYYSAYSPIPHADARLPGKSPPLVREHRLYQA
DWLLRFYGFDANELVAEADRNLSLDVDPKLAWALAHREYFPVDVNLAPREELLRIPGIGA
KSVARILKIRQHHALQVADLKKLRVAWKRTAHFVVTADHNPGLKKLDDLHLKQQFVQQPR
QLTLFDAHASAKSGEV
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacggcacaacaacggatgagtggccccctaagaagaaacaattgacgatgtcgcag
gacgttcagacgaaactcaaaattcttgccgacgccgccaagtacgatgcatcctgcgcc
agcagcgggtcgaagggaactcgccaaggaagcaagctgggcagtactgagggcatgggg
atctgtcacagctacacgccggatggcagatgcgtttcgctgctcaaaatccttatgacg
aactactgcatctacgactgtcaatattgcgtcaaccgagtcagcagcgacacgcctcgg
gctcgcttcacgaccgacgaaattgtggatctcacaattcagttctatcagcggaactat
atcgaggggctgtttttaagttccgggatcatccagtcgcccgattacaccatggagcag
atgaatctggtcgcgatgacgttgcgaacgaagcaccgatttggaggctacattcacttg
aagtccattcccggcgcgtctgacgatttgctggccgacgcgggacgctgggcggatcgc
ctgagtgtaaatgtcgaactgccgacggcgggagacctgcagcagcttgctccggaaaag
aaggaaccggagattactcatgcgatgggcaccatcaaggggcgaatcgacgagttcaaa
acggagaagaaggcgggtttcaaagtgccgaagttcgcccctgcgggccagagtactcag
atgattgtcggtgccacgcccacgccggatctggaaattcttcaaacggcctcatcgctg
tacaacaaccacgacctgcggcgagtctactattcggcctacagcccgatcccacacgct
gatgccagactgcccggcaagagtcctccgctggttcgcgaacatcgcctctaccaggcc
gactggcttctgagattctacggtttcgatgccaacgaactggttgcagaagcggaccgc
aacctatcgctggacgttgaccccaagctggcatgggcgctggcgcatcgggagtacttt
cccgttgatgttaatctcgctcctcgtgaggaactgctgagaattccaggcattggcgcg
aaaagcgtagctcgcatattaaaaattcgacagcaccacgcgctgcaggtggctgatttg
aaaaagcttcgcgtggcgtggaaacgcacggctcactttgtggtgacggcggatcataac
cccggtctgaaaaagctggacgacctgcacttaaagcaacaatttgtccagcagccacgg
caactcacgctgtttgatgctcacgcttctgccaaatcgggcgaggtgtga

DBGET integrated database retrieval system