KEGG   Fuerstia marisgermanicae: Fuma_04383Help
Entry
Fuma_04383        CDS       T04678                                 

Gene name
betB_2
Definition
(GenBank) Betaine aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fmr  Fuerstia marisgermanicae
Pathway
fmr00010  Glycolysis / Gluconeogenesis
fmr00053  Ascorbate and aldarate metabolism
fmr00071  Fatty acid degradation
fmr00280  Valine, leucine and isoleucine degradation
fmr00310  Lysine degradation
fmr00330  Arginine and proline metabolism
fmr00340  Histidine metabolism
fmr00380  Tryptophan metabolism
fmr00410  beta-Alanine metabolism
fmr00561  Glycerolipid metabolism
fmr00620  Pyruvate metabolism
fmr00625  Chloroalkane and chloroalkene degradation
fmr00903  Limonene and pinene degradation
fmr01100  Metabolic pathways
fmr01110  Biosynthesis of secondary metabolites
fmr01120  Microbial metabolism in diverse environments
fmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fuma_04383 (betB_2)
   00053 Ascorbate and aldarate metabolism
    Fuma_04383 (betB_2)
   00620 Pyruvate metabolism
    Fuma_04383 (betB_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Fuma_04383 (betB_2)
   00561 Glycerolipid metabolism
    Fuma_04383 (betB_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fuma_04383 (betB_2)
   00310 Lysine degradation
    Fuma_04383 (betB_2)
   00330 Arginine and proline metabolism
    Fuma_04383 (betB_2)
   00340 Histidine metabolism
    Fuma_04383 (betB_2)
   00380 Tryptophan metabolism
    Fuma_04383 (betB_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Fuma_04383 (betB_2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Fuma_04383 (betB_2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fuma_04383 (betB_2)
Enzymes [BR:fmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Fuma_04383 (betB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: APZ94744
UniProt: A0A1P8WL16
LinkDB All DBs
Position
5860800..5862281
Genome map
AA seq 493 aa AA seqDB search
MSIATETGSFAAPAVRQTGILIGDEWRPAVSGKTFKTINPATEEVICEVAEGDKEDVDLA
VHAARSAFESGSWSKMDARDRGRLMMKLADLMEENLDELAALETLDNGKPIGDARAADLP
LAIDCIRYYAGWADKIHGDTIPVRGDYFCYTRREPIGVCGQIIPWNFPILMTAWKWGPAL
SMGNTVVMKPAEQTPLTCLRLGELALEAGFPPGVINIVPGFGPTAGAAIVKHGLVDKIAF
TGSGETAQRIMVDAATTLKRLTFELGGKSPNIVFADADLDAAIAGAEFGLFFNQGQCCCA
GSRLFVEDSVHDEFVERVVSRASQRVLGNPFDSETTQGPQVDKDQFDKIMHYIDSGNKEG
AECVTGGQRVGNRGFFIEPTVFTNVNDDMAIAKEEIFGPVMSILKFSDMNEAISRANNTT
FGLAAAVWTSDVKKAHQIAASVRAGTVWVNCYDVFDAAAPFGGFKMSGMGRELGQAGLQN
YTELKTVTMALGD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagctaccgaaactggttccttcgcggctcccgctgttcggcaaacggggatc
ctgattggcgacgaatggcgaccggcggtcagcggcaagacctttaaaacgattaacccg
gccacggaagaagtcatttgcgaagtcgcggaaggcgacaaagaagatgtcgacctcgcg
gtacatgccgctcggtctgccttcgaaagcggatcctggtcgaagatggatgctcgggat
cgaggtaggctgatgatgaagctggccgacttgatggaagaaaatctcgacgaactcgcg
gcactggaaacgctggacaacggcaaacccatcggcgacgctcgagccgccgaccttccg
ctggcgattgactgcatccgctattacgctggctgggcagacaagattcacggcgacacc
attccggttcgcggtgattacttttgttatacacgccgcgaaccgatcggcgtgtgtggg
cagatcattccgtggaatttccccattctaatgacggcctggaagtggggtccggccctg
tcgatgggcaacaccgttgtgatgaagcctgccgaacaaacaccgctgacctgtttgcga
ctcggcgaactcgcattagaagcaggctttccgccaggcgtgattaacattgtgccaggc
ttcggtccgacggctggagcggccatcgtaaagcacggactggtcgacaagatcgcgttt
acaggctcgggcgaaacggctcagcgaatcatggtcgatgcggccacgacattaaaacgc
ctcaccttcgaactgggcggcaagtcgcccaacatcgtctttgccgacgctgatctggat
gccgcgattgccggtgctgagttcggcttgttcttcaatcagggccagtgctgttgtgcg
ggcagtcgattgtttgtggaagattcggtgcacgatgaatttgtggaacgagtggtctca
cgagccagccagcgcgtactgggcaacccattcgacagcgagacgactcaagggccgcag
gtcgacaaggatcagttcgacaaaatcatgcactacatcgacagcggcaacaaggaaggc
gccgaatgtgttacgggcggtcagcgcgtcggcaatcgcgggttctttattgagccgacc
gtgttcacaaacgtcaacgatgacatggccatcgcgaaagaagaaatcttcggcccggtg
atgagcattctgaagttcagcgacatgaacgaagcgatcagccgagccaacaacaccaca
ttcggcctcgccgccgccgtgtggacaagcgacgtgaagaaggctcaccagattgccgcc
agtgtgcgagcgggaaccgtgtgggtgaactgctatgacgtgttcgacgcggcagccccg
ttcggcggcttcaaaatgagtggcatgggtcgcgaactggggcaggccggtttgcaaaac
tatacggaactgaaaaccgtgacgatggctctgggtgattag

DBGET integrated database retrieval system