KEGG   Fuerstia marisgermanicae: Fuma_05226Help
Entry
Fuma_05226        CDS       T04678                                 

Gene name
nedA_2
Definition
(GenBank) Sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
fmr  Fuerstia marisgermanicae
Pathway
fmr00511  Other glycan degradation
fmr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Fuma_05226 (nedA_2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fuma_05226 (nedA_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:fmr02042]
    Fuma_05226 (nedA_2)
Enzymes [BR:fmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Fuma_05226 (nedA_2)
Bacterial toxins [BR:fmr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Fuma_05226 (nedA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR CHB_HEX_C
Motif
Other DBs
NCBI-ProteinID: APZ95567
UniProt: A0A1P8WNE6
LinkDB All DBs
Position
complement(6944704..6945909)
Genome map
AA seq 401 aa AA seqDB search
MSFSSLRATVAVLCCLSVSTTACWAESPVSNVFRSGSEGYNVFRIPAIVKAANGDLLAFC
EAREGGDASKIDLVSKRSTDNGKTWQPLQIVQAADDFRELFPKDAPPITVGNPAPVVDLL
DTEYPGRIWLPFTLENDRVFVTYSDNNGKSWATRREITSDVKLDTWGWYATGPVHSIQLQ
RGPHEGRLVIPCDHRLGDGGADRGPNGAHAIISDDHGTTWKLGAIDATYEDDLNANETTV
VELNDGRLYFNTRDQNGKAKGTRGDAFSSDGGETFDDATAGDYRWFAPSVELLDAPVVQC
ALLRGLSVKAGDASNLILFSGPDDSGPSGKGRSDLRIRYSTDESATWQDGPLIHEGPAAY
SDMVRLPDQQFGVLFEAGDKGGKNYARIDFAIFGVDEVGAK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcgtcacttcgtgctacagttgctgtcttgtgttgtctgtctgtgtcgacg
actgcctgctgggctgagtctccggtttctaacgtctttcgtagcggcagcgaggggtac
aacgtgtttcgcatccctgccatcgtcaaggctgccaacggtgacctgctggcgttctgc
gaagctcgtgaaggcggcgatgccagcaagattgatcttgtttctaaacgctcgaccgac
aacggcaagacctggcagccactacaaattgtgcaggcggctgacgattttcgggaactc
ttcccaaaggacgctccgccgattacggttggcaacccggcaccagttgttgacctgctg
gacaccgagtacccgggccgaatttggctgccattcacgctcgaaaacgatcgcgtgttt
gtcacctacagcgacaacaacggcaagtcgtgggcgactcgtcgcgaaatcacgtcggac
gtgaaacttgatacctggggttggtacgcgacggggcctgtacattccatacagttgcaa
cgcgggccgcacgaaggtcggcttgtgattccctgcgatcaccgtctgggagacggcggt
gcggatcgcggacccaacggagctcacgcgattataagcgacgatcacggaacgacatgg
aaattgggcgcgatcgacgccacttacgaagacgatctcaacgcaaatgaaaccacagtt
gtggaactcaatgatggccgtttgtacttcaacacccgcgaccaaaacggaaaggctaaa
ggcactcgcggcgatgcgttcagcagtgacggcggagaaactttcgacgacgcaacggcc
ggtgactatcggtggtttgcgccgtcggtcgaactactcgacgcgcccgtcgtgcagtgt
gctttgctgcgaggcctgtcagtcaaggcgggcgacgcttcgaacctgatcctgttctcc
ggccccgacgacagcgggccgtcagggaaaggtcgcagcgacttacgcattcggtattca
acggatgagtcggcaacgtggcaggatggcccgctgattcacgaaggcccggcggcctac
agcgatatggtccggctacccgatcagcaattcggggtgctgtttgaagcgggtgacaag
ggcggaaagaactacgccagaattgatttcgcaatcttcggcgtggatgaagtcggagcg
aaataa

DBGET integrated database retrieval system