KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0111Help
Entry
OOM_0111          CDS       T02112                                 

Definition
(GenBank) ribonuclease II family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Brite
KEGG Orthology (KO) [BR:fna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fna03016]
    OOM_0111
Enzymes [BR:fna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     OOM_0111
Transfer RNA biogenesis [BR:fna03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    OOM_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB FAD_syn TetR_C_19
Motif
Other DBs
NCBI-ProteinID: AFJ42673
UniProt: I2AWX6
LinkDB All DBs
Position
104684..106558
Genome map
AA seq 624 aa AA seqDB search
MLLENQSIKNALVIFKSKPAKVVEILDKKIEIETLDSKNIKLPAKNVQILTVLANDFDLA
KLEKLEIPELELTWELLQEQQQTSIDELRELLFEFVGANQAYTVWLLVSEGEYFSFNEDF
TINIHSQEQKDQIVSDKQEKLKKEQELNDFIECLNNKTFNIEDTKFLKEIEALATLKSTK
CRFFKYLNMEESENSAYKLLLDIGYWDEFFNPYLYRYGAELESNPAEFKYNSGSDSQRVD
LTHLTAYAIDDEGSNDPDDAISWDTQQNKMWVHIADPSSSINFGDEVDLEARARGSNLYV
PEHIITMLPPQATQKLGLGLQEVSPALSVGFRLNESSDIHDIEICFSNIKVTRYSYEFVE
ENISALELGDIGAYAKYFTNKRLTKGAVELDFPEIKISLDSDNNVKLTDLPRLNSRTLVR
DTMLMAGVAIGQFCKENNICVPFSTQPEHDLEQDDLENIDSIADMFATRKKLQRGKYSTE
PDVHAGMGLDSYVQVTSPLRRYLDLLVHYQLRNFLENKQMISVEDVDNIIAQVDIPIKSN
RQTERFSNSHWKLVYLMQNPNLEFQATVIEKLDKGRLMVSIADLAMTKKLAVSGKYDLND
QIKLQNTSVNLVTQEAFFKVIEEN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgttacttgaaaatcagagcatcaaaaatgccttagtaatttttaaatcaaaacctgca
aaggttgtagagatattagataaaaaaatagaaatagaaactttagatagtaagaatata
aagttacctgcaaaaaatgtccaaatacttacagttttagcaaatgattttgatttggct
aaacttgagaaattagaaattcctgagttagagttaacatgggagttattacaagagcaa
caacaaacatcaattgatgagttaagagagcttctttttgaattcgtaggagctaatcaa
gcttatactgtatggcttttagtttctgagggagagtattttagctttaatgaagacttt
actattaatattcattcacaagagcaaaaagatcaaatagttagcgataaacaagagaag
ctcaaaaaagaacaagaactaaatgattttatagagtgtcttaataataaaacttttaat
atcgaagacacaaaatttcttaaagaaatagaggctttagcaacacttaaaagtacaaaa
tgtcgtttctttaaatacttaaatatggaagagtctgagaatagtgcgtataagttactc
ttggatattggttattgggatgaattttttaatccttatttatatcgatatggtgcggag
ttagaaagtaatcctgcggaatttaaatataattctgggtcagatagtcagcgtgtcgat
ctaacacatctgactgcttatgctatagatgatgagggtagtaatgatcctgatgatgcg
attagttgggatactcaacaaaataaaatgtgggttcatatagctgatccatcttctagc
ataaattttggcgatgaagtagatcttgaagctagagcgcgaggttctaatttatatgtg
ccagagcatataatcacaatgttgccacctcaagcaacacaaaagttaggtttaggccta
caagaagtttctccagctttgtcagtaggatttagacttaatgagtcaagtgatattcat
gatattgaaatatgttttagtaacataaaagttactagatattcttatgagttcgttgaa
gaaaatatctctgctctagagcttggagacataggggcttatgctaaatatttcactaat
aagcgtttgacaaagggagcagtagagcttgattttcctgagataaaaatatcattggat
agtgataataatgtcaaactaactgacttaccacgcttaaactcaagaacattggtacgt
gatactatgctaatggctggagtggctattggacagttttgtaaagaaaataatatttgt
gtacctttttcaacacaaccagagcatgatcttgagcaagatgatttagagaatattgac
tcaatagccgatatgtttgcaacacgtaaaaagctccaaagaggtaaatattctacagaa
cctgatgttcacgcaggtatggggttagactcttatgtacaagtgacaagtcctctaaga
agatatttagatttgcttgttcattaccaattacgtaatttcttagaaaataagcaaatg
attagtgttgaagatgtcgataatataattgctcaagtagatattcctattaagtcaaat
agacaaacggagcgtttttctaattcacattggaaattagtatatctaatgcagaatcct
aatttagagttccaagcaacggttatcgaaaaactagataaaggtcgtttaatggtttct
atcgcagatttagcaatgactaaaaaacttgcagttagtggcaagtatgatttaaatgat
caaataaaactacaaaacacctctgtaaaccttgttacacaagaggctttctttaaggtt
attgaagagaattaa

DBGET integrated database retrieval system