KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0513Help
Entry
OOM_0513          CDS       T02112                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00970  Aminoacyl-tRNA biosynthesis
fna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OOM_0513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fna03029]
    OOM_0513
Enzymes [BR:fna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OOM_0513
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OOM_0513
Mitochondrial biogenesis [BR:fna03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OOM_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFJ43038
UniProt: I2AXZ1
LinkDB All DBs
Position
484348..485769
Genome map
AA seq 473 aa AA seqDB search
MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLLGTLPVVNKEAIRKAV
IFGLAVDAKISKDSFFARKNYFYPDLPKGYQISQSNNPIVQEGKLEIETSNGAKTIRIER
AHLEEDAGKSVHGYVAGETGLDYNRAGTPLLEIVTYPDFRSSEEVISYLKKLHQLVKHLG
ICDGNMQEGSFRCDVNLSIRPKGQDKFGTRAELKNINSFRFIDKAIEYEYARQIAVLESG
GEVVQETRLYDADANETRSMRAKEDAFDYRYFPDPDLLPLVITDEYIESIKKQVPLKPEE
REAVYREHLADQEVEFLLSNLEIADYYDEIAAVIGYKPAYNWITVDLISTLNRAEKEFSA
DIIPVEILLEIIDNVQKDVISQANAKKVIAEYIESVTSVANIIEKLGLKQVSDEGAIREL
VQGIIVANPQQAADFKAGKTKLTSFFVGQAMKASKGKANPKQVNQIVQEELNK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaattgggaaatggtgatagggctagaggtccatattcagttaagtactaaatctaag
ctgttttcgacttctgcaacaaaatatgggcagcatcaaaatactcaggctgcatttttg
gatttaggtttgctaggaactttgcctgtagtaaataaagaagctattcgtaaagctgtt
atatttggtttagctgtagatgctaaaatatcaaaagatagtttcttcgcacgtaagaat
tacttttatccagatttaccaaaaggctaccagattagtcaatctaataatccaatagtc
caagagggtaagctagagattgaaacttctaatggagccaaaactatcagaattgagagg
gctcatctagaagaagatgctggtaaatcagttcatggctatgttgctggcgagacaggg
ttagattataaccgtgcaggtacaccacttttagaaattgttacatatcctgattttagg
tcatctgaagaagtgatttcttatcttaagaagcttcatcagttagtcaagcatttgggt
atatgtgatggtaatatgcaagaaggctcgtttagatgtgatgtcaacttgtcaataaga
ccaaaaggtcaagataagtttggtactcgtgcagaacttaaaaacataaactcgtttaga
tttattgataaagcgattgagtatgaatatgctcgtcaaatagctgtgctggagtctgga
ggagaagttgttcaagaaactcgtctatatgatgctgatgcaaatgaaacacgctcaatg
cgcgcaaaagaggatgcttttgattatcgttacttcccagatccagatctattaccgttg
gtaataactgatgaatatatcgaaagtatcaaaaagcaggtgccacttaagccagaagag
cgtgaagcagtatatcgtgagcatttagctgatcaagaagttgagtttttattatcaaat
cttgaaatagcagattactatgacgaaatagcagctgtgataggttataagccggcgtat
aactggataacagttgatctaatatcaactcttaatagagcggaaaaagaattctcagca
gatattattcctgtagagattctattagagattattgataatgtacaaaaagatgttatc
tcacaagcaaatgccaaaaaagtcatagcagagtacattgagtcagtaacatctgttgct
aatatcatcgagaaactaggtttgaaacaagtatcagatgagggtgcgataagagaatta
gttcaaggtataattgtggctaaccctcaacaagcagctgattttaaagctggtaagact
aagcttacgagcttctttgttggtcaagctatgaaagcaagtaaaggtaaggcaaaccct
aagcaggttaatcaaatagttcaagaagagcttaataaataa

DBGET integrated database retrieval system