KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_36A2: HMPREF0946_00239Help
Entry
HMPREF0946_00239  CDS       T02822                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
fnc  Fusobacterium nucleatum subsp. vincentii 3_1_36A2
Pathway
fnc00970  Aminoacyl-tRNA biosynthesis
fnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HMPREF0946_00239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fnc03029]
    HMPREF0946_00239
Enzymes [BR:fnc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HMPREF0946_00239
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HMPREF0946_00239
Mitochondrial biogenesis [BR:fnc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HMPREF0946_00239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: EEU32166
UniProt: C7XMX3
LinkDB All DBs
Position
complement(976510..977967)
Genome map
AA seq 485 aa AA seqDB search
MNNLYELTAKELRDKFLSNELSAVEIVNSFYERIEKVEDKIKSFVSLRKDIALDEAKKLD
EKKKNGEKLGRLAGIPIAIKDNILMEGQKSTSCSKILENYIGIYNATVVKKLKEEDAIII
GITNMDEFAMGSTTKTSFHHMTSNPWDLNRVPGGSSGGAAASVAAQEVPISLGSDTGGSV
RQPASFCGVVGLKPTYGRVSRYGLMAFASSLDQIGTLAKTVEDVAICMNVIAGADDYDAT
VSKKEVPDYTEFLNKDIKGLKVGLPKEYFIEGLNPEIKNVIDNSVKALRELGAEVIEVSL
PHTKYAVPTYYVLAPAEASSNLARFDGIRYGYRAKDYTDLESLYVKTRSEGFGAEVKRRI
MIGTYVLSAGFYDAYFKKAQKVRTLIKQDFENVLNKVDVILTPVAPSVAFKLSDTKTPIE
LYLEDIFTISANLAGVPAISLPGGLVNNLPVGVQFMGRPFDEETLIKVADALEKKIGRLN
LPKLD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctttatgaattgactgcaaaagaattaagagataaatttttatctaatgaa
ctatcagcagtggaaatagttaattccttttatgaaagaatagaaaaagttgaagataaa
ataaaaagttttgtttctttaagaaaagatattgcacttgatgaggctaaaaaactagat
gaaaagaaaaaaaatggagaaaaattaggaagacttgctggtattcctattgcaataaaa
gataatattttaatggaagggcaaaagtcaacttcttgttctaaaatattagaaaattat
atagggatttataatgcaactgttgtaaaaaaattaaaagaagaagatgcaattattatt
ggtataacaaatatggacgaatttgctatgggatctacaacaaaaacttcctttcatcat
atgacatctaatccttgggatttaaatagagttcctggtggtagtagtggtggagcagct
gcctctgttgcagcacaagaagttccaatatctttgggatctgatacaggtggaagtgta
agacaaccagcttcattttgtggagttgttggattaaaaccaacttatggtagagtttca
agatatgggcttatggcatttgcttcatctcttgaccaaataggaacacttgcaaaaact
gttgaagatgttgctatttgtatgaatgttatagcaggagctgatgactatgatgcaaca
gtcagcaaaaaagaagtcccagattatactgaatttttaaataaagatataaaaggtttg
aaggttggattaccaaaagaatattttatagaaggattaaatcctgaaataaaaaatgtt
atagataattctgtaaaagcattaagagaattaggagcagaggttattgaagtttcattg
cctcatacaaaatatgctgttcctacttattatgtacttgcaccagcagaagcaagttct
aaccttgctagatttgatggtattagatatggatatagagcaaaagactatacagattta
gaaagtctatatgttaaaacgagaagtgaaggttttggagcagaagtaaaaagaagaatt
atgataggaacttatgttttaagtgctggtttctatgatgcttattttaaaaaagctcaa
aaagttagaacacttataaaacaagactttgaaaatgttttaaataaagtagatgttatc
ttaacacctgttgcaccaagtgtagcttttaaattatctgatacaaaaactccaatagaa
ttatatttggaagatatttttacaatatctgcaaacttagcaggtgtcccagcaatatca
ttgccaggaggacttgtaaataacttaccagttggagtacagtttatgggaagaccattt
gatgaagaaactttaataaaagtggctgatgcacttgaaaagaaaataggaagattgaat
ctacctaaattggattaa

DBGET integrated database retrieval system