KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_36A2: HMPREF0946_00268Help
Entry
HMPREF0946_00268  CDS       T02822                                 

Definition
(GenBank) hypothetical protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
fnc  Fusobacterium nucleatum subsp. vincentii 3_1_36A2
Pathway
fnc00071  Fatty acid degradation
fnc00280  Valine, leucine and isoleucine degradation
fnc00640  Propanoate metabolism
fnc00650  Butanoate metabolism
fnc01100  Metabolic pathways
fnc01110  Biosynthesis of secondary metabolites
fnc01120  Microbial metabolism in diverse environments
fnc01130  Biosynthesis of antibiotics
fnc01200  Carbon metabolism
fnc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HMPREF0946_00268
   00650 Butanoate metabolism
    HMPREF0946_00268
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0946_00268
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0946_00268
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF0946_00268
Enzymes [BR:fnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     HMPREF0946_00268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M HpaB_N Lipocalin_4
Motif
Other DBs
NCBI-ProteinID: EEU32195
UniProt: C7XN02
LinkDB All DBs
Position
1003662..1004807
Genome map
AA seq 381 aa AA seqDB search
MEFNVPKTHELFRQMIREFVENEVKPIAAEVDEEERFPIETVEKMAKIGIMGIPIPKEYG
GAGGDNLMYAMAVEELSKACATTGVIVSAHTSLGTWPILKFGTEKQKQKYLPKLASGEWI
GAFGLTEPNAGTDAAGQQTMAVQDPETGEWILNGSKIFITNAGYANVYVIIAMTDKSKGL
KGISAFIVEANTPGFSIGKKEMKLGIRGSSTCELIFENCRIPKENLLGDKGKGFKIAMMT
LDGGRIGIAAQALGIAAGALGEAIGYAKERKQFGRTLAQFQNTQFQIANLDVKVEAARLL
VYKAAWRESNNLPYSLDAARAKLFAAETAMEVTTKAVQIFGGYGYTREYPVERMMRDAKI
TEIYEGTSEVQRMVIAANVIK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaatgtacctaaaacacatgaacttttcagacaaatgataagagaatttgtt
gaaaatgaagtaaaacctatcgcagcagaggtagatgaagaagaaagatttccgatagaa
actgttgaaaaaatggcaaaaattggaataatgggtatccctataccaaaagaatatggt
ggagctggaggggataacctaatgtatgcaatggctgttgaagaattatcaaaagcttgt
gctacaacaggagttattgtatcagcacatacatctttaggaacttggccaatcttaaaa
tttggtactgaaaaacaaaaacaaaaatatttaccaaaattggctagtggagaatggata
ggagcttttggattaacagaaccaaatgcaggaacagatgctgctggacaacaaactatg
gcagttcaagatcctgaaacaggagaatggattttaaatggttcaaagatattcataaca
aatgcaggatatgcaaatgtttatgtaataattgcaatgactgataaatcaaagggatta
aaaggaatttctgcatttatagttgaagcaaatacacctggtttttctattggtaaaaaa
gaaatgaagctaggaattagaggatcatctacttgtgaattaatatttgaaaattgtaga
atacctaaggaaaatttacttggagataaaggaaaaggatttaaaattgctatgatgact
cttgatggaggaagaataggaattgctgctcaagcattaggaattgctgctggagcatta
ggtgaagctattggatatgctaaagaaagaaaacaattcggaagaactttggctcaattc
caaaatactcaattccaaatagctaacttagatgttaaagtagaagctgcaagactttta
gtttataaagcagcttggagagaatctaataatttaccttattctttagatgcagcgaga
gctaagttatttgctgctgaaacagctatggaagtaacaactaaggctgttcaaatattt
ggtggatatggatatacaagagaatatccagttgaaagaatgatgagagatgctaagatt
actgaaatctatgaaggaacttctgaagttcaaagaatggtaatagcagctaatgttata
aaataa

DBGET integrated database retrieval system