KEGG   Fusobacterium nucleatum subsp. animalis 7_1: FSDG_00611Help
Entry
FSDG_00611        CDS       T03612                                 

Definition
(GenBank) YihY family inner membrane protein
  KO
K07058  membrane protein
Organism
fne  Fusobacterium nucleatum subsp. animalis 7_1
Brite
KEGG Orthology (KO) [BR:fne00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    FSDG_00611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Shigella_OspC DUF1279 cPLA2_C2
Motif
Other DBs
NCBI-ProteinID: EEO42052
UniProt: A0A140PSG8
LinkDB All DBs
Position
997009..998259
Genome map
AA seq 416 aa AA seqDB search
MKNLFENFGSKKFNTKNLKLMLKRAYEKYQSANSSFWVTSLSFYTILAIVPILAILVSLS
SWFGAEDYIINQIKDIAPLKGGTLELLTDFSNNLLMDARSNVLAGVGFLFLGWTFIQMFS
LIEASFNEIWHIKKSRSIIRKISDYISFFIFLPLLFIILNGLVLFLLSKIKEIVFLYYIV
KNIFPLISMTIFFMALYLVMPNTMVKIIPAFIASVIVSIAFLLFQYIFILLQFLLIGYNT
VYGGFSVIFIFLIWVRICWFIVILGVHITYLIQNANFDINIENDTINISFNSKLYITFKV
LEEIVKRYLNNQSPPNMTDLRKVTTSSPFLIGNALDDLIRGGYVLSSRDYSEKVFCIAKN
IEEVSLKEIYDFIANTGEEIYILQDGEITDNIEKIIIDKDYSRTLKSLGGEVAEKN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttatttgaaaattttggttcaaagaaatttaatactaaaaatttaaaattg
atgttgaaaagagcatacgaaaagtatcaaagtgctaattctagcttttgggtaacatct
ctatctttttatactatcttggcaatagttccaatacttgctattctagttagtttaagt
agttggtttggagcagaagactatataataaatcagattaaagatatagctcctctaaaa
ggtggaacattggaattacttactgatttttcaaataatttattaatggatgccagaagc
aatgttttagcaggagtaggtttcttatttttaggttggacgtttatacaaatgttctct
cttattgaagcttcttttaatgagatttggcatataaaaaaatcaagaagtataataaga
aaaatcagtgattatatatcattttttatttttttacctttactatttattattttaaat
ggacttgtgttatttttgttatcaaaaataaaggaaatagtatttctttattatatagta
aaaaatatttttcctttaataagtatgacaatattctttatggcactttatttagttatg
ccaaatacaatggtaaaaattattcctgcttttatagcatctgtaatagtatcaatagct
tttttactatttcaatatatttttattttattacaatttttattgataggctataataca
gtatatggtggtttttcagtaatatttatatttttgatatgggtaagaatatgttggttt
atagtaattttaggagttcatataacatatttaatccaaaatgctaactttgatataaat
atagaaaatgacactattaatatcagttttaattcaaaattatatataacatttaaagtt
ttagaagagattgtaaaaagatacttaaataatcaatctcctccaaatatgactgattta
agaaaggttactacttcatctccttttttaattggaaatgcattagatgatttaatcaga
ggtggttatgtacttagtagtagagattattcagaaaaagtcttttgtatagctaaaaac
atagaagaggtctctttaaaagagatatatgattttattgctaatacaggtgaggaaata
tatatattacaagatggtgaaattactgataatatagaaaaaattataatagataaagat
tatagtagaacattaaagagtttaggaggagaagttgcagaaaaaaattaa

DBGET integrated database retrieval system