KEGG   Fusobacterium nucleatum subsp. animalis 7_1: FSDG_01353Help
Entry
FSDG_01353        CDS       T03612                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fne  Fusobacterium nucleatum subsp. animalis 7_1
Pathway
fne00010  Glycolysis / Gluconeogenesis
fne00051  Fructose and mannose metabolism
fne01100  Metabolic pathways
fne01110  Biosynthesis of secondary metabolites
fne01120  Microbial metabolism in diverse environments
fne01130  Biosynthesis of antibiotics
fne01200  Carbon metabolism
fne01230  Biosynthesis of amino acids
Module
fne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fne_M00002  Glycolysis, core module involving three-carbon compounds
fne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FSDG_01353
   00051 Fructose and mannose metabolism
    FSDG_01353
   00562 Inositol phosphate metabolism
    FSDG_01353
Enzymes [BR:fne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FSDG_01353
Exosome [BR:fne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FSDG_01353
  Exosomal proteins of bladder cancer cells
   FSDG_01353
  Exosomal proteins of melanoma cells
   FSDG_01353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3793
Motif
Other DBs
NCBI-ProteinID: EEO42794
UniProt: A0A140PVZ2
LinkDB All DBs
Position
227583..228338
Genome map
AA seq 251 aa AA seqDB search
MRRLVIAGNWKMYKNNKEAVETLTKLKDLTKDVKNVDIVIGAPFTCLSDAAKTVEGSNIK
IAAENVYPKTEGAYTGEISPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIG
MKPILCIGEKLEEREGGKTLTVLSKQIKGGLVDLSKEEAEKVIIAYEPVWAIGTGKTATP
EMAEETHKAIRNVLTEMFGKDVADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKA
DSFFEIIKAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagattagttattgcaggaaactggaaaatgtataaaaacaataaagaagctgtt
gaaacattgacaaaattaaaagatttaacaaaagatgtaaaaaatgtagatatcgttata
ggagcaccatttacttgtctttcagatgcggctaaaactgttgaaggaagcaatataaaa
atagcagcagaaaatgtatatcctaaaacagagggagcatacacaggggaaatttctcct
aaaatgcttaaagatattggggttacttatgtaattttaggacattctgaaagaagagaa
tattttaaagaaagtgatgaatttataaatcaaaaagttaaagcagttttagaaatagga
atgaaacctatactttgtataggagaaaaattggaagaaagagaaggtggaaaaaccctt
acagttttgagtaaacagataaaaggaggacttgtagatttatctaaggaagaagcagaa
aaagttataattgcctatgaaccagtttgggcaataggaacaggaaaaacagctactcct
gaaatggcagaagaaactcataaggcaattagaaatgtcttgactgaaatgtttggaaaa
gatgtagcagataagatgataattcaatatggtggttcaatgaaaccagaaaatgcaaaa
gatttgttaagccaagaagatattgatggaggacttgttggaggagcttcattaaaagca
gattcattctttgaaattataaaagcaggaaattaa

DBGET integrated database retrieval system