KEGG   Francisella noatunensis subsp. orientalis LADL--07-285A: M973_01100Help
Entry
M973_01100        CDS       T02952                                 

Definition
(GenBank) D-alanyl-alanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fnl  Francisella noatunensis subsp. orientalis LADL--07-285A
Pathway
fnl00473  D-Alanine metabolism
fnl00550  Peptidoglycan biosynthesis
fnl01100  Metabolic pathways
fnl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fnl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M973_01100
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M973_01100
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M973_01100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fnl01011]
    M973_01100
Enzymes [BR:fnl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M973_01100
Peptidoglycan biosynthesis and degradation proteins [BR:fnl01011]
 Precursor biosynthesis
  Amino acid ligase
   M973_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp RimK TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHB97842
LinkDB All DBs
Position
192468..193361
Genome map
AA seq 297 aa AA seqDB search
MQKEKIVVLYGGDSPEREVSLISGKAVLDSLLNQGYNAVGLDASSKDLVVKLLELNPDKC
FIALHGEDGENGRVAALLEMLRIRHTGSTMKSCVVTMDKMISKEIWMHHRMLTPMAKFLT
DKLVDADEISFPVAVKPSSGGSSIATFKVKSFEELENAYEQASKYGEVMIEQWVTGKEIT
VAIVNNDVYSSVWIEPLNEFCDYESKYSGKSIYHAPSGLCEQKELEVRQLAKKAYDLLGC
KGHARVDFIYDDKGDFYIMEINSSPGMTENSLSPKCAAAEGIDFDSFVKLILEQAQC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagaaaaaattgtcgttttatatggtggagattctccagaaagggaagtgtct
ttaatatctggtaaagcagttttggactctttactaaatcaaggttataacgcggttggt
ttagatgcaagctcaaaagatttggttgttaagcttttggagttaaatcctgataaatgt
tttatcgcactgcatggcgaagatggcgaaaatggtagagttgctgcattacttgaaatg
ttacgcataaggcacactggttcgactatgaagtcatgcgttgtaactatggataaaatg
atttccaaggaaatatggatgcatcatcgtatgcttacaccgatggcaaaatttcttact
gataagttagtggatgctgatgagattagttttcctgttgctgttaagccaagtagtggt
ggatctagtatagctactttcaaagtaaaaagctttgaagagcttgaaaatgcttatgaa
caagcatcaaagtatggtgaagtaatgattgaacagtgggtcactggtaaggagataacg
gtggctattgttaataatgatgtttattcatctgtttggatagagccattaaacgagttt
tgtgactacgagtcaaaatatagcggcaagtctatatatcatgcaccaagtggattatgt
gagcaaaaagagctagaggttcgacagttggctaaaaaagcttatgatctattgggctgc
aaaggtcatgctcgagtagattttatatatgatgataagggagatttctatattatggag
attaattcatctccaggaatgacagagaatagtctatctcctaagtgtgcggcggctgaa
ggtattgattttgacagctttgttaaattaatactagaacaggcgcaatgctaa

DBGET integrated database retrieval system