KEGG   Francisella noatunensis subsp. orientalis LADL--07-285A: M973_06415Help
Entry
M973_06415        CDS       T02952                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fnl  Francisella noatunensis subsp. orientalis LADL--07-285A
Pathway
fnl00240  Pyrimidine metabolism
fnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    M973_06415
Enzymes [BR:fnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M973_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 FAD_binding_4 AAA_30
Motif
Other DBs
NCBI-ProteinID: AHB98532
LinkDB All DBs
Position
complement(1163474..1164067)
Genome map
AA seq 197 aa AA seqDB search
MAKLYFRYSAMDAGKTLDLLKVTYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGIDQDAY
SLTDQDNIFEFVKDYNEKHKVDCVLIDEIHFFTQEQVWQLSDIADQLDIPVICYGLRTNY
LGQPFETAALLLAIADTLEEVKTICHCGKKASFNMMVQNGKAIKEGNPIVVDDNSLKDID
TRYVSVCRKHWKKGEYQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaattatattttagatattcagcaatggatgcaggtaaaacattggatctctta
aaagtaacttataattatgaagatagaggtagaaagcctttagttctaacttcagcaata
gataaaagagcgggtttaaataaagttaaatcacggataggtatagatcaagatgcttat
tcattgacggatcaagataacatctttgaatttgtcaaagactataacgaaaaacataag
gtagattgtgttttaattgatgagatacatttttttactcaagagcaagtctggcaactt
tctgatattgcagatcagctagatataccagttatctgctatggactacgaactaactat
ttaggtcaaccttttgaaactgcagctttattgcttgcaattgcagacactttagaagag
gtcaaaactatctgtcactgtggtaaaaaagctagttttaatatgatggtgcaaaatggt
aaagctataaaagagggtaatccaatagttgttgatgataattctttaaaagatatcgat
actcgatatgtttcagtgtgtcgtaaacattggaaaaaaggtgagtatcaataa

DBGET integrated database retrieval system