KEGG   Fervidobacterium nodosum: Fnod_0697Help
Entry
Fnod_0697         CDS       T00579                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00564  Glycerophospholipid metabolism
fno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Fnod_0697
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Fnod_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 Thi4 NAD_binding_8 FAD_binding_3 Pyr_redox_3 TrkA_N HI0933_like Ald_Xan_dh_C2 3HCDH_N UDPG_MGDP_dh_N ApbA NAD_binding_7 F420_oxidored TfuA Pyr_redox Lycopene_cycl 2-Hacid_dh_C Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABS60552
UniProt: A7HKW9
LinkDB All DBs
Position
760978..762420
Genome map
AA seq 480 aa AA seqDB search
MRVAVIGAGSVGALIARELSRYDLEVIIIEKNVDVGMGVTKANSAIVHAGYDDEPGTVRS
KFCVPGNKMYTELSKELEIDLKRIGSLVLAFKDEEVRTLEELYKRGEQNGVEGMEIWDRD
KVLSYEPNVNPEVIAALWAPTAGITEPWMVAIAAVENAVENGAKLFLETEVLDIITKNGK
VEKIITNKGEFEVDIIINAAGLYADEIAKMANADYVPLHPRKGEYILLDKQEFSGFVKSV
LFPTPSILGKGTLVTPTVDGGILVGPTAVDLPPEREFREDTSTTFEGFESLISKALKMTP
LIDFRTSIKTFAGLRPESPQKDFLVGRTRITGFFNAMAMRSPGLTAAPAIAKFMVEEIQE
SVGETFVPKSDFNPIRKRIKHYADMPLTLWDQEIKNDPLTGKMICFCNKVTEKEILEAIK
RGASTIDSIKFRTRAMFGSCQGGFCMHRIMKILARELGKDISEIRLRSEKSVVLNGKVRQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtagctgtaataggtgccggttctgtaggagcgttaatagcccgcgaattatct
cgttacgatttagaagtcattataatcgaaaaaaacgtagatgttggaatgggagttaca
aaagcaaattcagcaattgttcatgccggatacgatgatgaacctggaacagtacgttca
aaattctgtgtaccgggtaataaaatgtacacagaattatcaaaagaattggaaatagac
ttaaaaagaatcggatctttggtgttagcattcaaggacgaagaagttagaaccctcgaa
gaactttacaaacgtggagagcaaaatggtgtagaaggtatggaaatatgggatagggat
aaggtactttcttatgaaccgaatgttaatccagaagtaattgctgctctgtgggcccca
acagccggtataacggaaccttggatggtggcaattgccgcggttgaaaatgctgttgaa
aatggtgcaaaattgtttttagaaacagaggtacttgatatcattacaaaaaatgggaaa
gttgaaaaaataataacaaataaaggagaatttgaggttgatataattataaacgccgca
ggtttatatgctgatgagatagcaaaaatggcaaatgccgactatgtgccacttcatcca
agaaaaggggaatatatattactcgataaacaagaattcagtggttttgtcaaaagtgtg
ctcttcccaaccccttccattcttggaaaaggaacactcgtaaccccaaccgttgacggt
ggaattttagttggacctaccgctgtagatcttcctccagagagagaattcagagaagat
acgtcaacaacatttgaaggttttgaatcgctcatttcaaaggctctaaaaatgactcct
ctcattgattttagaacttctataaaaacatttgctggtcttaggccagaaagcccacaa
aaagattttctcgttggaagaacaagaataaccggatttttcaacgctatggcaatgcgt
tcgcctggtttaacagccgcaccagcgatagcaaaattcatggtcgaagaaattcaagaa
tctgttggggaaacgtttgttccaaaatctgatttcaatccaattagaaagagaattaaa
cattacgcagatatgccacttacattatgggatcaggaaattaaaaatgatccactcacc
ggcaaaatgatatgtttttgcaataaggtaactgagaaagaaattcttgaagcaataaaa
agaggtgcaagtacaatcgatagcataaaatttagaacacgggcaatgtttggaagttgc
caaggtggattttgtatgcataggataatgaaaattttggcaagagagcttggcaaggat
atatcagaaataagactaagaagcgaaaaaagtgttgtactgaatgggaaggtgagacaa
tga

DBGET integrated database retrieval system