KEGG   Fervidobacterium nodosum: Fnod_0798Help
Entry
Fnod_0798         CDS       T00579                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00240  Pyrimidine metabolism
fno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Fnod_0798
Enzymes [BR:fno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Fnod_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 Nucleotid_trans AAA_30 AAA_22 ABC_sub_bind AAA_19 Spherulin4
Motif
Other DBs
NCBI-ProteinID: ABS60651
UniProt: A7HL68
LinkDB All DBs
Position
complement(875732..876319)
Genome map
AA seq 195 aa AA seqDB search
MSNKIGKLTVIVGPMYSGKTTELLNYAEIYELGRKKILILKPQIDTRYSKDDVVTHKFFK
MPARAIKDVQEMEEYYKSLNEKPDAIFIDEVHFFDSSLTKLVKEITKDGVDVYCAGLDMN
YLWDPFETTAMLMAVADEVIKKRAVCEVCGEYKGTLSYKKKSNGGIFDVGGKEKYIAVCK
ECYEELKSKEEGKLI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaataagataggaaaactcacggtaatagttgggccaatgtattctggaaaaact
acagaacttcttaactatgctgagatatatgagcttggtcggaaaaaaatacttatactt
aaaccacaaattgatacaaggtacagtaaagatgatgttgtaacacataaattttttaaa
atgccggcacgagcaattaaagatgttcaagagatggaagaatattataaatctttaaat
gaaaagccagatgcaatttttatagatgaagtacatttttttgattcttcacttacaaaa
ttagtaaaagaaataactaaagatggcgtagatgtttactgtgcgggcttggatatgaat
tatctttgggatccttttgaaactactgcaatgcttatggctgttgctgacgaagttatt
aaaaaaagggccgtgtgcgaagtttgtggggagtataaagggactttgtcttataagaaa
aagtcaaatggtgggatatttgatgttggtggtaaagaaaaatacattgctgtatgtaaa
gaatgttatgaagaattaaaaagtaaagaggagggaaaattaatatga

DBGET integrated database retrieval system