KEGG   Fervidobacterium nodosum: Fnod_1306Help
Entry
Fnod_1306         CDS       T00579                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00260  Glycine, serine and threonine metabolism
fno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fnod_1306
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Fnod_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 AdoHcyase_NAD FAD_binding_3 NAD_binding_7 Met_10 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABS61153
UniProt: A7HMM0
LinkDB All DBs
Position
1411793..1412839
Genome map
AA seq 348 aa AA seqDB search
MNTMKAIMKEKAGPGLVLKEVKRPDVNDLGPRDVLVKVRRASICGTDVHIYKWDEWSQSR
IIPPLITGHEMAGEVVAVGSAVTRVNIGDLVAAETHIPCESCYQCKTGRMHVCKNLKILG
VDTNGIFAEYAIIPESVLWRFSSEIPLDFASVMEPFGNAIHTASVTNLLGKNVLITGAGP
IGLMAIQVAKVAGASTVIVSEVDPMRIKMAQENGADVIINPAEKDLVKEVYKILDDGVDV
LLEMSGNRKAFEDGLKCVTMGGEVSVLGIFGGKIDINLDSLITMRGLTVYGITGRRMFET
WRIADELLRTKKVDLSKVVTHVIPFEQWEKGFELMLNKQCGKVVLNLD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatgaaagctattatgaaagaaaaagccggtccaggattggtgttaaaagaa
gttaaaaggccagatgtaaacgatcttggtccacgcgatgttttggttaaagttcgaaga
gcttcaatttgtggtacggatgtacacatatataaatgggatgagtggtcacaatcaaga
attattcctccactaataacagggcatgaaatggcaggagaagttgtcgctgttggtagt
gctgttacaagagtaaatattggagatttagtcgcagcggaaactcacataccttgcgaa
agttgttatcaatgcaaaactggtagaatgcatgtttgtaaaaatttgaaaatattaggt
gttgatacaaatggtatatttgcagaatatgcaattattcccgaaagtgttttgtggaga
ttttcttccgagattcctcttgacttcgcatctgttatggaaccattcggaaatgctatt
cataccgcatctgtaactaatttacttgggaagaacgtccttataaccggtgcaggtccg
ataggtcttatggcaattcaagtggctaaagttgccggcgcaagcacagtaattgtgtcc
gaagtcgatccaatgagaattaaaatggctcaggaaaatggggcggatgtaattataaat
cccgcggaaaaagatttagtgaaggaagtttacaaaattcttgatgatggtgttgacgtg
cttcttgaaatgagcggtaacagaaaagcatttgaagatggattaaaatgtgttacgatg
ggtggcgaagtttccgttcttggtatatttggtggaaaaatagatataaacttagactct
cttatcacaatgaggggattaactgtatatggtatcacaggaagaagaatgtttgaaact
tggagaattgcggatgaattacttaggacgaagaaggttgacctttcaaaggttgttacc
cacgttatcccgtttgagcaatgggaaaagggatttgaattgatgttgaataaacaatgt
ggaaaggttgttctaaatcttgattaa

DBGET integrated database retrieval system