KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_27: HMPREF0405_01905Help
Entry
HMPREF0405_01905  CDS       T03625                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fnt  Fusobacterium nucleatum subsp. vincentii 3_1_27
Pathway
fnt00010  Glycolysis / Gluconeogenesis
fnt00051  Fructose and mannose metabolism
fnt01100  Metabolic pathways
fnt01110  Biosynthesis of secondary metabolites
fnt01120  Microbial metabolism in diverse environments
fnt01130  Biosynthesis of antibiotics
fnt01200  Carbon metabolism
fnt01230  Biosynthesis of amino acids
Module
fnt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fnt_M00002  Glycolysis, core module involving three-carbon compounds
fnt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0405_01905
   00051 Fructose and mannose metabolism
    HMPREF0405_01905
   00562 Inositol phosphate metabolism
    HMPREF0405_01905
Enzymes [BR:fnt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0405_01905
Exosome [BR:fnt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0405_01905
  Exosomal proteins of bladder cancer cells
   HMPREF0405_01905
  Exosomal proteins of melanoma cells
   HMPREF0405_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3793
Motif
Other DBs
NCBI-ProteinID: EFG33712
LinkDB All DBs
Position
1:complement(1664872..1665627)
Genome map
AA seq 251 aa AA seqDB search
MRRLVIAGNWKMYKNNKEAVETLTQLKDLTKDVKNVDIVIGAPFTCLSDAVKTVEGSNIK
IAAENVYPKIEGAYTGEISPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIG
MKPILCIGEKLEEREGGKTLEVLAKQIKGGLIDLSKEAAEKVIIAYEPVWAIGTGKTATP
EMAEETHKAIRNVLTEMFGKDVADKVTIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKA
DSFFEIIKAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagactggttattgcaggaaactggaaaatgtataaaaataataaagaagctgtt
gaaacattgacacaattaaaagatttaacaaaagatgtaaaaaatgtagatatcgttata
ggagcaccatttacttgtctttcagatgcagttaaaactgttgaaggaagcaatataaaa
atagcagcagaaaatgtatatcctaaaatagaaggagcttacacaggggaaatttctcct
aaaatgcttaaagatattggagttacttatgtaattttagggcactctgaaagaagagaa
tattttaaagaaagtgatgaatttataaatcaaaaagttaaagcagttttagaaatagga
atgaaacctatactttgtataggagaaaagttagaagaaagagaaggtggaaaaactctt
gaagttttagctaaacagataaaaggaggacttatagatttatctaaggaggcagcagaa
aaagttataattgcctatgaaccagtttgggcaataggaacaggaaaaacagctactcct
gaaatggcagaagaaactcataaggcaattagaaatgtcttgactgaaatgtttggaaaa
gatgtagcagataaggtgacaattcaatatggtggttcaatgaaaccagaaaatgcaaaa
gatttgttaagtcaagaagatattgatggaggacttgttgggggagcttcattaaaagca
gattcattctttgaaattataaaagcaggaaattaa

DBGET integrated database retrieval system