KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0410
Entry
FN0410            CDS       T00077                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00030  Pentose phosphate pathway
fnu00051  Fructose and mannose metabolism
fnu00052  Galactose metabolism
fnu00680  Methane metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01200  Carbon metabolism
fnu01230  Biosynthesis of amino acids
fnu03018  RNA degradation
Module
fnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0410
   00030 Pentose phosphate pathway
    FN0410
   00051 Fructose and mannose metabolism
    FN0410
   00052 Galactose metabolism
    FN0410
  09102 Energy metabolism
   00680 Methane metabolism
    FN0410
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FN0410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fnu01009]
    FN0410
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fnu03019]
    FN0410
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FN0410
Protein phosphatases and associated proteins [BR:fnu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FN0410
Messenger RNA biogenesis [BR:fnu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FN0410
SSDB
Motif
Pfam: PFK NAD_kinase DAGK_cat
Other DBs
NCBI-ProteinID: AAL94613
UniProt: Q8RG98
LinkDB
Position
1047370..1048359
AA seq 329 aa
MRVKIKKMEKKLAILTSGGDAPGMNAAIRATAKIAEYYGFEVYGIRRGYLGMLNDEIFPM
TGRFVSGIIDKGGTVLLTARSEEFKEARFREIAANNLKKKGINYLVVIGGDGSYRGANLL
YKEHGIKVVGIPGTIDNDICGTDFTLGFDTCLNTILDAMSKIRDTATSHERTILIQVMGR
RAGDLALHACIAGGGDGIMIPEMDNPIEMLALQLKERRKNGKLHDIVLVAEGVGNVLDIE
EKLKGHINSEIRSVVLGHIQRGGTPSGFDRVLASRMAAKAVEVLNKGEAGVMVGIEKNEM
VTHPLEEACSVDKRKSIEKDYELALLLSK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgagggtgaagattaaaaaaatggaaaaaaaattagctatattaacaagtggtggagat
gcaccaggaatgaatgccgcaataagagcaacagcaaaaattgctgagtattatggattt
gaagtttatggaataagaagaggatatttaggaatgttaaatgatgaaatatttcctatg
actggtagatttgtatcagggattattgataagggtggaacagttttactgacagctcgt
tcagaagaatttaaggaagccagattcagagagattgcagcaaataatttaaaaaagaaa
ggtataaactacttagtggttataggtggagatggttcttatcgtggagctaacttactt
tataaagaacatggaataaaagtagttggaataccaggaactattgataatgatatctgt
ggaacagattttactcttggatttgatacatgtcttaatacaattttagatgcaatgtca
aaaataagagatacagcaacatctcatgaaagaacaattttaattcaagttatgggaaga
agagcaggagatttagctctacatgcttgtatagcaggtggtggagatggaataatgata
cctgaaatggataatcctattgaaatgctagcactccaattaaaagaaagaagaaaaaat
gggaagctacatgatatagttttagttgcagaaggtgttggaaatgtattggacattgaa
gaaaaattaaaaggacatattaacagtgaaattagatcagttgttttaggacatattcaa
agaggaggaacaccatcaggatttgatagagttcttgcaagtagaatggcagcaaaagca
gttgaagtattgaataaaggggaagcaggagttatggttggaattgaaaaaaatgaaatg
gtaactcatccacttgaagaagcttgttctgttgataagagaaagagtattgaaaaagac
tatgaattagcacttttactatcgaaataa

DBGET integrated database retrieval system