KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0991
Entry
FN0991            CDS       T00077                                 

Definition
(GenBank) CDP-diacylglycerol--serine O-phosphatidyltransferase
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00260  Glycine, serine and threonine metabolism
fnu00564  Glycerophospholipid metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
Module
fnu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FN0991
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0991
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     FN0991
SSDB
Motif
Pfam: CDP-OH_P_transf Importin_rep_2
Other DBs
NCBI-ProteinID: AAL95187
UniProt: Q8REU8
LinkDB
Position
1645950..1646735
AA seq 261 aa
MVKKKYIAPNLITAGNMFLGYLSITESIKNNFNMAIWFILLAMVCDGLDGKTARKLDAFS
EFGKEFDSFCDAVSFGLAPSMLIYSILTKNVPGSPFIVPVSFLYALCGVMRLVKFNIINV
ASSEKGDFSGMPIPNAAAMVVSYIMICNVLETTFGLTIFNIRVFIAISVISAGLMVSTMP
FKTPDKTFSFIPKKLALIIILGLLISMYWTLNYSVFIISYTYVLLNILTYFYKRFGSEEE
KDEDELTEEFIEVDENEEKGE
NT seq 786 nt   +upstreamnt  +downstreamnt
atggttaaaaagaagtatattgctcctaatcttattacagcaggaaatatgtttttaggt
tatttaagtataactgaatcaataaaaaataattttaatatggctatatggtttatttta
cttgctatggtctgtgatggtttagatggaaagacagctagaaagctagatgcatttagt
gaatttgggaaagaatttgattcattttgtgatgcagtttcatttggactagctccatca
atgttaatttattcaatattaacaaaaaatgttccaggaagtccatttatagttccagtt
tcatttctatatgctctttgtggagtaatgagattagttaaatttaatattatcaatgtt
gcttcaagtgaaaagggagattttagtggaatgcctattcctaatgctgctgcaatggtg
gtatcttatattatgatttgtaatgttttagaaacaacatttggcttaactatttttaat
ataagagtttttatagcaatttcagtaatatcagcaggactaatggtaagtacaatgcca
tttaaaacacctgataaaaccttctcgtttattcctaaaaaattagctttaattattatt
ttaggacttttgatttctatgtattggacattaaattatagtgtatttattatttcttac
acttatgttttactaaatatacttacatatttttataaaagatttggaagtgaagaagaa
aaagatgaagatgagctaacagaagagtttatagaagtagatgaaaatgaagaaaaaggt
gagtaa

DBGET integrated database retrieval system