KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1508
Entry
FN1508            CDS       T00077                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00740  Riboflavin metabolism
fnu00790  Folate biosynthesis
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FN1508
   00790 Folate biosynthesis
    FN1508
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     FN1508
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     FN1508
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: AAL93634
UniProt: Q8RIR1
LinkDB
Position
12978..14177
AA seq 399 aa
MIYKIEDVLEDIKNGIPLIIVDDENRENEGDLFVAAEKATYESINLMATFARGLTCTPMT
SEYAIRLGLDPMTARNTDAKCTAFTVSVDAKEGTTTGISIADRLTTIKKLANKNSVPSDF
TKPGHIFPLIAKDKGVLEREGHTEATVDLCKICGLTPVSVICEILKDDGTMARMDDLEIF
AKEHNLKIITIADLIKYRKKTEQLMKIDVVANMPTDSGTFKIVGFDNLIDGKEHIALVKG
DVAGKENVTVRIHSECFTGDILGSLRCDCGSQLKTAMRRIDKLGEGIILYLRQEGRGIGL
LNKLRAYNLQEEGMDTLDANLHLGFGADMRDYAVAAQMLKALGVKSIKLLTNNPLKINGL
EEYGIPVVKREEIEIEANKINKVYLKTKKERMGHLLKIK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgatttacaaaattgaggatgtattagaagatattaagaatggtattcctctaataata
gtagatgatgaaaacagagaaaatgaaggagacctttttgttgctgctgagaaagcaact
tatgaaagtattaatcttatggcaacatttgcaagaggtttaacttgtacacctatgaca
agcgaatatgcaatcagattaggtttagatccaatgactgcaagaaatactgatgcaaaa
tgtactgcctttactgtatctgttgatgcaaaagaaggaactacaactgggatttcaata
gctgatagacttacaacaataaaaaaattagcaaataaaaattctgttccatcagatttt
acaaagcctggacatatttttccactgattgcaaaagataaaggtgtgttggaaagagaa
ggacatactgaggcaacagttgatttatgtaaaatttgtggactcacacctgtatctgtt
atctgtgaaattttaaaagatgatggtactatggcaagaatggatgatttagaaattttt
gctaaagagcataatttaaaaattattacaatagctgatttaatcaaatacagaaaaaag
actgaacaacttatgaaaattgatgttgttgctaatatgccaactgatagtggcacattt
aaaattgtaggttttgataatctcattgatggtaaagaacatattgcccttgtcaaaggt
gatgttgctggtaaagaaaatgttacagttagaatacactctgaatgtttcacaggagat
attttaggttctttaagatgtgattgtggttctcaattaaaaactgcaatgagaagaatt
gataaacttggagaaggaattattctttatctaagacaagaaggtaggggtataggactt
ttaaataaattaagagcctataatcttcaagaagaaggtatggacacactagatgcaaat
ttacatcttggttttggtgcagatatgagagattacgctgttgctgcacagatgttaaaa
gcattaggagtaaaatctataaaacttttaacaaataacccattaaaaataaatgggctt
gaagaatatggaattcctgttgttaaaagagaagaaattgagattgaagctaataaaatt
aataaagtatacttaaaaactaaaaaagaaagaatgggacatcttttaaaaattaaataa

DBGET integrated database retrieval system