KEGG   Formosa sp. Hel3_A1_48: FORMA_08700Help
Entry
FORMA_08700       CDS       T04482                                 

Definition
(GenBank) glycosyltransferase, GT2 family
Organism
foh  Formosa sp. Hel3_A1_48
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Cellulose_synt Anp1
Motif
Other DBs
NCBI-ProteinID: AOR26041
UniProt: A0A1D7XRT7
LinkDB All DBs
Position
919645..921135
Genome map
AA seq 496 aa AA seqDB search
MLLESIIIVVYSTALILIFMYALAQLNLLFNYLGAPKSSSQDEKFDLSNPDQVPFVTIQL
PVYNEMYVMERLLDNIVKLEYPSHKLEIQVLDDSTDESIETTSEQITRLQDKGFNIQHIR
RENRTGFKAGALKEGLTVAKGEYIAIFDADFLPKSDWLKRTIPYFKNDKIGVVQTRWGHI
NRDYSVLTRVQAFALDAHFTLEQVGRNTKGHFINFNGTAGIWRKECIIDAGNWEGDTLTE
DLDLSYRAQLKNWEFKYLEHVETPAELPVVISAARSQQFRWNKGGAENFRKMIGRVFSSK
NLSLKTKIHGMLHLLNSTMFLNVLIVGILSIPMLYIKNEYAHLKAYFYVMSFFVISTLIF
FICYWYMYKKTHGTSLKSFVQYIVLFFTFFSIAMGFSLHNSIAVIEGHIGKRSEFVRTPK
FNMNSLTDSWKNNKYIRKKPSLNVVLEGLLMLYFAFGMYSAFIVGDQGGDFGLFPFHLML
FVGFGFVFFNSLKSKT
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctcttagagtctatcatcattgttgtatattcaacagcgctcatcctaatattcatg
tatgcgcttgcccaattgaacctactgttcaactacttaggcgcccctaagtccagctcc
caggatgaaaaattcgatttatctaatccagatcaagtaccatttgttactattcagctt
ccagtatacaacgagatgtatgtaatggaacgccttctggacaatattgtcaaattagag
tatccaagtcataaacttgagattcaagtcttggacgactcgacagatgaatcaatcgaa
accacatcagaacaaataacacgtctacaagataaggggtttaatattcaacatataaga
agagaaaatagaacaggtttcaaagcaggagcactaaaggagggtctaactgtggcaaaa
ggtgaatatatagctatttttgacgccgattttctcccaaaatctgattggctaaagcgt
actattccctacttcaaaaatgataaaataggtgttgttcaaacacgttggggacacatc
aatagggactattctgtgcttacaagagtgcaagcatttgcacttgatgcacatttcact
ttagaacaagtagggcgaaatacaaaaggccactttataaactttaatgggacggcaggt
atctggcgtaaggaatgtattattgatgccggtaactgggaaggcgatacactgaccgaa
gatttagatttaagctatcgtgcgcaattgaaaaattgggaattcaaatatttagagcat
gtagaaacccccgccgaactgcctgtggtgatcagtgccgcacgatcacaacaatttcgc
tggaacaaagggggggctgaaaattttagaaaaatgattgggcgtgtattttccagcaaa
aacttatctctaaaaacgaaaatccacggcatgttgcacttgctcaacagtacgatgttt
ttgaatgtacttatcgtgggaattctaagcatcccaatgttgtatatcaaaaatgaatat
gctcacttgaaagcttatttttatgtgatgagtttctttgttataagtacgctcatattt
tttatatgttactggtatatgtacaaaaagacacacggtacttctctaaagagttttgta
caatatattgtgctgttttttacatttttttccatcgcaatgggcttctctttacacaat
tctatcgctgttattgaaggtcatattggcaaacgaagtgagtttgttcgtaccccaaaa
ttcaacatgaattcgctaaccgacagttggaaaaataataaatatattcgcaaaaaacca
tcactgaatgttgttttagaagggcttttgatgctgtattttgcttttggtatgtacagt
gcttttattgtcggcgatcaaggtggagactttggtttattcccattccacttgatgttg
tttgttggctttggctttgtgttttttaactccctcaaatctaaaacttaa

DBGET integrated database retrieval system