KEGG   Formosa sp. Hel3_A1_48: FORMA_11730Help
Entry
FORMA_11730       CDS       T04482                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00240  Pyrimidine metabolism
foh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FORMA_11730
Enzymes [BR:foh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FORMA_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AOR26336
UniProt: A0A1D7XSN5
LinkDB All DBs
Position
1219196..1219837
Genome map
AA seq 213 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDVRYDDER
VISHDANEIRSTPVPAASNIPLLADGCDVVGIDEAQFFDDEIVSVCNVLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSFRKLNDDKLVLLGEVNEYEP
LSRSAFYKAMTEEKIKGIKVVDPENIADNKTEN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaaccctaaagaacaatttggatggattgaagtcatctgt
ggatccatgttttctggaaaaacagaagagttgattcgtcgcctaaaacgtgctcaattt
gccaaacaaaaagttgaaatatttaaaccggcaatagatgtccgctacgacgacgaacgt
gttatttctcacgacgctaacgaaattcgatcgacgcccgtgcccgctgcttccaatatc
cctcttcttgctgacggctgcgatgttgtgggtatagacgaagctcaattttttgatgac
gaaatagtgagcgtctgtaatgtgctggccaacaaagggattcgtgtaattgttgcggga
ttagatatggactttaaaggcaacccattcggtcctatgccgaatctcatggctacagcc
gaatatgtcactaaagtgcacgctgtttgcacaagaacaggaaacttggcccagtatagc
ttccgcaaattaaatgacgataagcttgtgctcttaggtgaagtaaacgaatatgagccc
cttagtcgtagcgcgttttacaaagctatgactgaggaaaagataaaaggtattaaagtt
gtagaccctgaaaatatagcggataataagaccgaaaattaa

DBGET integrated database retrieval system