KEGG   Formosa sp. Hel3_A1_48: FORMA_15720Help
Entry
FORMA_15720       CDS       T04482                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00620  Pyruvate metabolism
foh00680  Methane metabolism
foh01100  Metabolic pathways
foh01120  Microbial metabolism in diverse environments
foh01200  Carbon metabolism
Module
foh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FORMA_15720
  09102 Energy metabolism
   00680 Methane metabolism
    FORMA_15720
Enzymes [BR:foh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FORMA_15720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOR26722
UniProt: A0A1D7XTU1
LinkDB All DBs
Position
1662378..1664954
Genome map
AA seq 858 aa AA seqDB search
MAVQPKLERFKKNVLSKFQIYNSIFMTLPFDQITKTGVLLPLFHETCEKGYAAGDNPSAI
VETFFQKYQARRTKKSQIKLLFRFIQYIERQVVLFDAIEDAAFPVINNMDGIGTLRSLKE
KAFSENKIEELKAYLDEFKVRIVLTAHPTQFYPGSVLGIITDLTEAIKDNDLSRINNLLA
QLGKTPFFKHKKPTPYDEAVNLIWYLENVFYDSFGSIFDYIQQNIYDHKIIKNEIINIGF
WPGGDRDGNPFVLPDTTLKVAGLLQKSILKNYAKDLKKLRRKLTFRGVEDSLNDLIANAY
SAIDKPGAFDLEAFLSELKEVRKIVKRDHHSLYLSEITSLINKIQLFGHHFATLDIRQDS
RIHHSVFSKIVEKSKEANNKIFPENYNELSEDQQINVLSELDAVLDTSIFEDELVKNTLQ
TIKVVKEIQNTNGEKGAHRYIISNNQTALNVMQLYAMLKLVAFNDRLSIDIVPLFETVTD
LENAPKVMEQLYTNKAYKAHLRSRGQKQTIMLGFSDGTKDGGYFMANWAIFKAKEALTQI
SKQYNIDVVFFDGRGGPPARGGGKTHQFYASLGPTIEDKEVQLTIQGQTISSNFGTPDSS
KYNLEQLISSGLSNSLGSENKGFSDEDRATMDELATLSYKAYQDFKGHPKFIPYLERIST
LKYYAKANIGSRPSKRSKSDRLIFSDLRAIPFVGSWSQLKQNVPGFFGVGTAIRSFEDRG
ELEKVIALYNNSSFFKTLLENSMMSLSKSFFALTKYMAEDEEFGPFWNIIYSEYELSLRL
LLKVTGCKELMENEPSGKASIEVRESIVLPLVTIQQYALRKIQQLQKQKTIDKEQIEVFE
KIVTRTLYGIINASRNSA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcaacctaaattagagcgtttcaagaaaaatgtgttatcaaaatttcagata
tacaatagtatattcatgacacttccttttgaccaaatcacaaagacaggggtcttgctt
cctttgtttcacgaaacttgtgaaaaaggttatgctgctggcgataaccctagcgctatt
gtcgagacgttttttcaaaagtatcaagcacgacgtactaagaaaagccaaatcaaatta
ttgtttcgttttattcagtacattgagcgtcaggtagttttatttgatgccattgaagat
gctgcttttccggtcatcaataacatggatgggattgggactttacgcagtttgaaagag
aaagcattttcagaaaataaaatagaagagctaaaagcgtacctggatgagtttaaggtc
cgtattgttctgacggcacaccccactcaattttaccctggctcagttttaggaatcatc
acagatctaaccgaggcgattaaggataacgacttgagtcgaatcaataatttacttgct
caactaggtaaaaccccattctttaagcataagaaacctacaccttatgatgaagctgta
aaccttatatggtatttagaaaacgtattttacgattcttttggatctatttttgattac
atacagcaaaatatttacgaccacaaaatcataaaaaatgaaattataaatattgggttt
tggccaggcggagaccgtgatggaaacccatttgtccttccggacaccactttgaaagtc
gctgggttacttcaaaaatcaatattgaaaaattacgccaaggatttaaaaaaacttcgc
agaaaactcacctttcgtggggtagaagactcactaaatgatttgatagcaaatgcatac
agtgcaattgacaagcctggagcatttgacctagaagcttttcttagcgaattgaaagaa
gttagaaaaattgttaagcgcgatcatcattctttgtatttaagtgaaattacgagcttg
atcaataaaattcaactttttggacaccattttgcaactttggatatacgccaagacagt
agaattcaccacagcgtattttcaaaaattgttgaaaaatctaaagaagctaataacaaa
atctttccagaaaactacaatgagttgtctgaggatcaacaaattaatgttctctctgaa
ctagatgctgtacttgatacttctatttttgaagatgaattagtcaaaaacacacttcaa
accatcaaggtagtcaaggagattcaaaatacaaacggagaaaaaggcgcacaccgctat
atcattagtaacaatcaaactgccttgaatgtgatgcaattgtatgccatgctaaaactg
gtagcatttaacgatcgactttcaatcgacatagttccgttgtttgaaacggttacagat
ttggagaatgcacctaaagtgatggagcaattgtataccaacaaagcatacaaagcgcac
ttaagatctcgtgggcaaaagcaaaccataatgttagggttttctgatgggactaaagac
ggcgggtattttatggctaattgggcaatattcaaggctaaagaggcattgacacaaata
tcaaagcaatacaatattgatgttgtcttttttgacgggcgaggtggccctccagcccga
ggcggcggaaaaacgcatcagttttatgcttctcttggcccaactattgaggacaaagaa
gttcagcttacgattcaagggcaaactataagctctaattttggaactccagattcctca
aaatataatttagaacaattgataagctctgggctatccaatagtttaggttcggaaaac
aaaggcttttccgatgaagaccgtgcaactatggatgagttagcaaccttgagctataaa
gcttatcaagacttcaaagggcatcccaagtttattccatatctagagcgtatcagtaca
ttaaaatactatgccaaagccaacattgggagtcgcccctcaaagcgatcaaaatcagac
cgcttgattttttctgatctaagagcaataccttttgtaggctcttggagtcagttgaag
caaaatgttccaggattttttggggttggaactgctattcgttcttttgaagatcgagga
gagctggaaaaggtcattgctttgtacaacaactctagtttctttaaaacccttcttgag
aacagtatgatgtctctgagtaaatcgttttttgcacttacaaaatatatggccgaagat
gaagagtttggtccattttggaatataatttacagtgagtatgagttaagcttacgcttg
ttgttaaaagttactggctgcaaagagttaatggaaaatgaaccaagtggaaaagcttca
atagaggttcgtgagtctattgtgctgcccttagtaacgatacagcaatatgcgctaaga
aagattcagcagctacaaaaacaaaaaaccatcgataaggagcaaattgaggtgtttgaa
aagattgtgacgcgtacgctgtatggcatcatcaatgcgagtagaaactctgcctaa

DBGET integrated database retrieval system