KEGG   Formosa sp. PS13: FNB79_08785Help
Entry
FNB79_08785       CDS       T06103                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
fop  Formosa sp. PS13
Pathway
fop00270  Cysteine and methionine metabolism
fop00450  Selenocompound metabolism
fop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FNB79_08785
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FNB79_08785
Enzymes [BR:fop01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     FNB79_08785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 Met_gamma_lyase DegT_DnrJ_EryC1 GDC-P Beta_elim_lyase RabGAP-TBC
Motif
Other DBs
NCBI-ProteinID: QDO94070
UniProt: A0A516GRS7
LinkDB All DBs
Position
complement(2007913..2009115)
Genome map
AA seq 400 aa AA seqDB search
MSFKPANNIQDLQLFGEDGGVNPSISDSSTYTFLSAKTMQDTFDGKTDGCYLYSRHTSPS
NLNLSRALAAMEGTETATVYASGMGAITSVLLQLCEAEDHIISSRTIYGGTYAFLKNFTP
KFNINTSFIDITNTDLVEAAITSNTKLIYCECVSNPLLEIADLKALAKLAKTYNLKLVVD
NTFSPLSITPATFGADVVIHSLTKFINGSSDTLGGVVCGTFDFINQLKDVNSGAAMLLGS
TMDSMRAASIFKNLKTLHLRMIQHSKNALYLAEKFEAHGLKTIYPGLASHPGHHIYKTQM
NTAFGYGGMLTIDVGSFEKANALMELMQHKNIGYLAVSLGFYKTLFSAPGSSTSSEIPIS
EQEDMGLTNGIIRFSIGLDADIERTYKMIYNCMKELHILK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaacccgcaaataatattcaagatttacaattatttggagaagacggaggc
gttaacccttcaatttcagactcgtcaacatatacattcttatccgctaaaaccatgcaa
gacacttttgacggaaagactgatggttgctatttatactccagacacacatcgccttct
aatctaaatttatctcgtgcgctagctgcaatggaaggtactgaaacagccacggtatat
gcttctggaatgggcgcaatcacatcggtattacttcagttgtgtgaagccgaagaccat
attatatcaagccgtaccatatacggtggcacctatgcttttttaaaaaactttacgcct
aaatttaatataaacacaagctttatagatattactaacacagatcttgtagaagctgct
attacgtctaacacaaaacttatttattgtgaatgtgtgagcaatcccttattagaaata
gcagatttaaaagccctagctaaacttgctaaaacatataatttaaaactcgtagtagat
aatacgttttcgcctttaagtataacacctgccacatttggagcagatgtagtgatacat
agtttaactaaatttattaatggaagtagcgatactttaggcggtgttgtatgcggtact
ttcgactttattaatcaattaaaagatgttaactctggtgcagctatgctattagggtct
acaatggatagcatgcgtgctgcttcgatatttaaaaacctaaagacgcttcatttaaga
atgatacaacatagtaaaaatgctttgtatttagctgaaaaatttgaagctcatggatta
aaaacaatatatccaggtttagcatctcaccctggacaccacatttacaaaacccaaatg
aataccgcttttggatatggaggcatgcttactatagatgtcgggtcttttgaaaaagct
aatgcattaatggaacttatgcaacataaaaacattggttatcttgctgtaagtttagga
ttttacaaaacgctcttttctgcaccaggaagctctacttcttcagaaatccctatttcc
gaacaagaagacatgggccttaccaatggtattataagattctctatcgggctagatgcc
gatatagaacgcacatataaaatgatatacaattgtatgaaagaattacatattttaaaa
taa

DBGET integrated database retrieval system