KEGG   Formosa sp. Hel1_33_131: FORMB_11960Help
Entry
FORMB_11960       CDS       T04465                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00620  Pyruvate metabolism
for00680  Methane metabolism
for01100  Metabolic pathways
for01120  Microbial metabolism in diverse environments
for01200  Carbon metabolism
Module
for_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:for00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FORMB_11960
  Energy metabolism
   00680 Methane metabolism
    FORMB_11960
Enzymes [BR:for01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FORMB_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOR28242
UniProt: A0A1D7XY43
LinkDB All DBs
Position
complement(1276627..1279131)
Genome map
AA seq 834 aa AA seqDB search
MTLPFDSITKTGALLPLFFETCQKGFANNEDPTTIVNSFFKKYQARRSPKSQINLLFRFI
QYIERQVVLFDAIEDAAFPIVNNMDGIGTLRSLKETATSENKLEILQKYLEEFKVRIVLT
AHPTQFYPGSVLGIITDLTEAIRENDLFRINELLAQLGKTPFFKQTKPTPYDEAVSLIWY
LEHVFYKSFGTVYDYIQQNIFDGKHIDNDIINIGFWPGGDRDGNPFVTPEITLKVAARLR
ETIIKNYYRDIRGLKRKLSFAGVEERITALEVELYKIITHKKSSLTVEYLTAELKEIKEA
IIEKHQSLYVSEVNSLLNKIHLFGFHFSTLDIRQDSREHAKVFNDMVNVSIESGSDVFPK
NYHSLAEKDQIKILSTIKGSVDLSLISDKDTLKALKTMEAIKTIQQTNGEKAANRYIISN
NQTTLHVMQLYAMLKLVAFHDKLTVDVAPLFETITDLENAPSVMEDLYSNPNYMAHLKAR
GNRQTIMLGFSDGTKDGGYLMANWAIYKAKELLTEMSRKFDITVIFFDGRGGPPARGGGK
THNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDSSQYNLEQLISSGIHNSLSDKDLRMT
PENREVMAQLSKLSYEAYVDFKAHPKFISYLEHMSTLKFYAKTNIGSRPSKRGKAEGLVF
EDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDIGEFDKAQHLFQTSDFFKTLIENSMM
SLSKSFFDLTKYMSEDPEYGAFWNLIYSEYITTKRLLLKLTGYEELMEEEPAGKASISVR
ESIVLPLLTIQQYALKKIQELEKEEPRDEAQIETYEKIVMRSLFGNINASRNSA
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgccgtttgattccattaccaaaacaggcgcgttgttgccacttttttttgag
acctgtcaaaaaggatttgcgaataatgaagaccctaccacaattgtaaactcatttttt
aaaaaataccaagcccgacgctcgcctaaaagtcaaatcaatttactgtttcgttttata
cagtacatagaacgtcaagtggtgttgtttgatgccattgaagatgctgcgtttcctatt
gtaaacaatatggacggaattggaaccttgagaagtttaaaagaaaccgctacctctgaa
aataaattagaaattctacaaaaatatttagaagaatttaaagtgcgtattgtgctcacg
gcgcatcccacgcaattttaccccggctctgtattggggatcatcaccgatttaacggaa
gccatccgcgaaaatgatttatttcgcatcaacgaactgttagcacaactcggtaaaaca
ccttttttcaaacaaaccaaaccaacaccctacgatgaagcggtcagtctaatttggtat
ttagagcatgtattttacaagtcttttggaaccgtttatgattacattcaacaaaatatt
tttgatgggaagcatattgataacgatattattaacattggtttttggcccggaggcgac
agagatggcaatccttttgtgaccccagaaatcacgctcaaagtggcggcgagacttcgt
gaaacgatcattaaaaattactaccgagacatccgcggactaaaaagaaaattatctttt
gcgggcgtcgaagagcgtataacagcattggaagtcgagctttacaagattataacacat
aaaaagtcgagcttaacagtcgagtatttaaccgcagagttaaaagaaattaaagaggct
attattgaaaaacaccagtcgctctatgtttctgaagtgaacagtctgttaaataagatt
catttatttggatttcatttttctactctagacatccgtcaagacagtcgcgaacacgcc
aaagtgtttaatgacatggtaaatgtgtcgattgaaagtggtagcgatgtatttcctaaa
aactaccacagcttagcagaaaaagatcaaattaaaattctttcgacaattaaaggctca
gtagatttgtcattaatttcagacaaagatacattgaaggctctcaagacaatggaggcc
ataaaaaccattcaacaaaccaatggagagaaggcagccaaccgctatattataagcaac
aaccagacaacacttcatgtgatgcaattgtatgccatgcttaagttggtcgcttttcac
gacaaactaacggttgatgtggcgcctctttttgaaacgatcaccgatttagaaaatgca
ccttccgtaatggaagatttgtattcgaatcctaattatatggcacatctaaaagcacgt
ggcaacagacaaaccataatgcttgggtttagtgacggtacaaaagatggtggctattta
atggccaattgggctatttataaagcaaaagaattgctaacggagatgtctagaaaattt
gacatcaccgtaattttctttgacggtcgaggcggcccgcctgcaagagggggtggaaaa
acacataatttttatgcgtctttaggacctacaatcgaggataaagaagtgcagcttacc
atacaagggcaaacgatcagttcaaattttggaaccttagactcctcacaatacaatctt
gaacaattgatcagctctggaattcataacagtcttagtgataaagaccttagaatgacg
cctgaaaatagagaggtcatggcgcagttgtctaaattgagttatgaggcctatgtagat
tttaaagcgcatcctaagtttatttcttacttagaacacatgagtactttgaagttttat
gcgaaaaccaatattgggagtcgtccttcaaaacgtggaaaagcagaaggcttggtgttt
gaagatttacgcgccattccatttgtaggttcttggagtcagttgaaacaaaatgtccct
ggattctttggcgttggaaccgccctcaaacattatgaagacattggcgagtttgacaaa
gcacaacacttgtttcaaacctcagattttttcaaaacactgattgaaaatagcatgatg
tccttgtctaaatccttctttgatttgacaaagtacatgtctgaagaccctgaatacggt
gctttttggaatctcatttatagcgaatacatcaccacaaaacgattgttattaaaacta
accggttatgaggagttgatggaagaggaacctgctggaaaggcttctatctccgttaga
gaatcgattgtattgccgttattaacgatccaacaatatgccttaaagaaaattcaggaa
cttgaaaaagaagagcctagagacgaagctcagatagaaacgtacgagaaaattgtcatg
cgctctttatttgggaatatcaatgcgagtcgaaactctgcataa

DBGET integrated database retrieval system