KEGG   Formosa sp. Hel1_33_131: FORMB_11980Help
Entry
FORMB_11980       CDS       T04465                                 

Definition
(GenBank) aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00010  Glycolysis / Gluconeogenesis
for00053  Ascorbate and aldarate metabolism
for00071  Fatty acid degradation
for00280  Valine, leucine and isoleucine degradation
for00310  Lysine degradation
for00330  Arginine and proline metabolism
for00340  Histidine metabolism
for00380  Tryptophan metabolism
for00410  beta-Alanine metabolism
for00561  Glycerolipid metabolism
for00620  Pyruvate metabolism
for00625  Chloroalkane and chloroalkene degradation
for01100  Metabolic pathways
for01110  Biosynthesis of secondary metabolites
for01120  Microbial metabolism in diverse environments
for01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FORMB_11980
   00053 Ascorbate and aldarate metabolism
    FORMB_11980
   00620 Pyruvate metabolism
    FORMB_11980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FORMB_11980
   00561 Glycerolipid metabolism
    FORMB_11980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FORMB_11980
   00310 Lysine degradation
    FORMB_11980
   00330 Arginine and proline metabolism
    FORMB_11980
   00340 Histidine metabolism
    FORMB_11980
   00380 Tryptophan metabolism
    FORMB_11980
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FORMB_11980
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FORMB_11980
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FORMB_11980
Enzymes [BR:for01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FORMB_11980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOR28244
UniProt: A0A1D7XY36
LinkDB All DBs
Position
1280009..1281562
Genome map
AA seq 517 aa AA seqDB search
MNTNSTDFKIQEALDALGVKDINLGTSTGANSFSNGPSIDSFSPVDGKRIGSVVCTSQED
YEAVMAAATAAYPEWRTMPAPQRGEIVRQFGNKLRDLKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHPIGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKGSEKAPLCSIACQNIIAEILKENNLPEGISSIINGDYKVGEMMTTDTRV
PLVSATGSTRMGRIVGATVAQRFGKSLLELGGNNAIIITPTADLKVVVPGAIFGAVGTCG
QRCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDEKNHIGPLIDHDSVNTYLAAIEK
AKAEGGTVLVDGGVLEGEGYESGCYVKPAIIEAENHFEIVQHETFAPILYLMKYSGAVEN
AIQKQNGVAQGLSSAIMTNELKEAEKFLSYAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTINYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaactcaactgattttaaaatccaagaagcactggatgctcttggtgtaaaa
gacataaatttaggaacgtccacgggcgcaaatagtttttctaacgggcctagtatcgac
agtttttctcctgtagatggtaaaagaattggaagtgtggtttgcacttctcaagaagat
tatgaagcagtgatggcagcggcaacggctgcatacccagagtggcgaaccatgcctgca
cctcaacgtggcgaaattgtgcgtcagtttggaaacaagctaagagatttaaaagaaccc
cttgggaaattggtgtcttatgaaatggggaaatcccttcaggaaggctatggagaggtt
caagaaatgattgatatctgtgattttgcggttggattgtctcgacagttaaacggacag
acgattccttctgagcgtcctggccacgtgatgcgagagcaatggcatccgattggtgtg
gtgggtattatctctgcgtttaattttccagtggctgtttgggcttggaatacggctttg
gcttggatctgtggcgatgtatgtgtgtggaaaggttctgaaaaagcgcctttatgctct
attgcctgtcagaatattattgctgaaattttaaaagaaaataacttgcctgaaggaatt
tcttcaatcatcaatggcgattacaaagtgggtgaaatgatgacgacggacacgagagtg
cctttagtgtctgcgaccggttctacaagaatgggaagaattgttggtgccacggttgct
caacgctttggaaaatcgttgttggaattaggaggaaataatgcgattattatcacgcca
accgccgatttaaaagtggtggtgcctggtgctatttttggtgcggtaggaacttgcgga
caacgttgtacttctacacgacgactcattattcacgagtctgtatatgataaagtaagg
gatgcgattgtgggtgcttatgggcagttaaccattggaaatcctttggatgaaaaaaac
catattgggcccttgatcgatcatgattctgtaaatacatatttagcggctattgaaaaa
gcaaaagctgaaggcggtactgtattggttgatggtggtgttttagaaggtgaaggttat
gaaagtggctgttatgtgaagccagcgattattgaagctgaaaaccattttgagattgta
cagcatgaaacgtttgcgcctatcttatatttaatgaaatattctggggcggtagaaaat
gccatccaaaaacaaaacggtgttgcgcaaggcttgtcttctgcgattatgaccaacgag
cttaaagaggctgaaaagttcttgtcttatgcaggttctgactgtggaattgccaatgta
aatattggaacttctggagcagaaattggcggtgcttttggtggtgaaaaagaaacagga
ggcggacgtgagtctggttctgatgcatggaaagtgtatatgcgacgtcaaacaaatacc
attaattattcggatgaattgcctttggcacaagggattaagttcgatttgtaa

DBGET integrated database retrieval system