KEGG   Formosa sp. Hel1_33_131: FORMB_12350Help
Entry
FORMB_12350       CDS       T04465                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00240  Pyrimidine metabolism
for01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FORMB_12350
Enzymes [BR:for01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FORMB_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AOR28280
UniProt: A0A1D7XYM8
LinkDB All DBs
Position
1309938..1310585
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPAIDVRYDDEM
VVSHDANEIRSTPVPSASNIPLLADGCDVVGIDEAQFFDDEIVNVCNALANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTHTGNLAQYSHRKSKNDNLVLLGEVDEYEP
LSRAAYYKALLKEKLQDMDVVNPTDVDTNKNNSNA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaaccctaaagaacaatttggttggatcgaagtcatctgc
ggatcgatgttttctggaaagactgaagaattaattcgtcgcttacgacgggctcaattt
gccaagcaaaaagttgagatttttaagcctgccattgatgtgcgttacgacgatgaaatg
gtggtgtctcacgatgccaatgaaattcgttctacgcccgtaccttccgcttccaacatc
ccgcttttagcagatggatgcgatgtggttggtattgatgaagcgcaattttttgatgat
gaaattgtaaacgtgtgtaacgcccttgccaataaaggcattcgggtgattgttgcgggt
ctggatatggactttaaaggaaacccttttgggccgatgccaaatttgatggcaaccgca
gaatatgttaccaaagtgcacgctgtgtgtacgcatacaggaaatttagcccagtacagc
catcgtaaatctaaaaatgacaatctggttcttttgggcgaagttgatgaatatgagcca
ctcagtcgagccgcttactataaagcactcctaaaagaaaagttgcaagacatggatgtt
gtaaacccaaccgatgttgacaccaacaaaaataactcaaatgcctaa

DBGET integrated database retrieval system