KEGG   Formosa sp. Hel1_33_131: FORMB_18080Help
Entry
FORMB_18080       CDS       T04465                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00010  Glycolysis / Gluconeogenesis
for00020  Citrate cycle (TCA cycle)
for00620  Pyruvate metabolism
for01100  Metabolic pathways
for01110  Biosynthesis of secondary metabolites
for01120  Microbial metabolism in diverse environments
for01130  Biosynthesis of antibiotics
for01200  Carbon metabolism
Module
for_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FORMB_18080
   00020 Citrate cycle (TCA cycle)
    FORMB_18080
   00620 Pyruvate metabolism
    FORMB_18080
Enzymes [BR:for01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FORMB_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AOR28841
UniProt: A0A1D7XZT1
LinkDB All DBs
Position
complement(1892979..1894556)
Genome map
AA seq 525 aa AA seqDB search
MEEGTVASWLKKVGDKIEEGDILAEIETDKATMEFESFNEGTLLHIGVQEGETTMVDELL
AIIGDEGEDISALLNPTAAVEETTTEETEAPLEAAAAVVEPSTASIPDGVIVVTMPRLSD
TMEEGTVASWLKQVGDVIEEGDILAEIETDKATMEFESFNEGTLLYIGLQEGDSAKVDDL
LAIIGPAGTDVSAVAANFSTTATAVVEADLTETPKVPAAEVKETPKAAAAPVAVAIPNTT
GRLHISPLARKMADDKGIALNQLVGSGENGRIIKRDVENFTPAAASSAASAAKFVPTGQE
DFEEIKNSQMRKTIAKRLGESKFSAPHYYLNVEFDMDNAMAFRAQYNTVPDTKISFNDII
VKACALALRLHPQVNSQWFADRMKLNNHVHVGVAVAVEDGLVVPVVRFANEQSLPQIGAA
VRDFAGRARNKKLTPQEMDDSTFTVSNLGMFGIESFTSIINQPNSAILSVGAIVQKPVVK
NGQIVVGNTINLTLACDHRTVDGATGAQFLQTLKGFIENPVTMLV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggaaccgtggcgagctggttgaaaaaagtaggagacaaaattgaagaaggt
gatattcttgcggaaatcgaaaccgataaagcaacgatggaatttgaatcctttaatgaa
ggaaccttgcttcatattggtgttcaagaaggggaaacgaccatggtcgatgagcttctt
gccattattggagatgaaggcgaagacatatcggcactgttgaatccaacggctgccgta
gaagaaacaactacagaagaaacagaggctccattagaagccgctgctgccgttgtggaa
ccaagtacagcaagcattcctgatggtgtgattgtggtgactatgccgcgcttaagcgac
accatggaagaagggactgttgcgagctggctcaaacaagttggggatgtgatcgaagaa
ggcgatattttagctgaaatcgaaacggataaagcaaccatggagtttgaatcctttaat
gaaggcaccttattatacattggactccaagaaggcgactctgcaaaagtagacgatctt
ttagcgattattggccctgcaggaacggatgtttcagcggttgctgctaacttttcgacg
actgcaacagccgttgtagaagcagacctcacagagacacccaaagtacctgctgccgaa
gttaaagaaacacccaaagcagccgctgcacccgttgcagtcgctatacccaatacaaca
gggcgtttgcatatttcgccactcgcgcgaaaaatggcggacgacaaaggcattgccttg
aaccaattggttggaagtggtgaaaacggacgcatcatcaaacgcgatgttgaaaacttc
acccccgcagcagcaagttctgccgcaagtgcagcgaagtttgtaccgacaggtcaagaa
gactttgaagaaatcaaaaactcgcaaatgcgtaaaaccattgcgaaacgtttgggcgaa
tctaaattctctgcacctcattattacttgaatgtagagtttgacatggacaatgccatg
gcgtttagagcacaatacaatacggttccagatactaaaatatcatttaacgacatcatt
gtcaaagcctgtgcattggcattgcgtttgcaccctcaagtgaattcacaatggtttgca
gatcgcatgaaactcaacaaccatgtacacgttggtgtggcggtggcggttgaagatggt
ttggtcgttcctgtagtgcgttttgccaatgagcaaagcttgccacaaataggcgctgca
gttagagattttgcgggacgtgcacgaaataaaaaattaacccctcaagaaatggacgac
agtacatttaccgtgtctaacttaggaatgtttggaattgaaagctttacgtcgattatc
aaccaacccaactcagcaattttatcggtgggagcgattgttcaaaaaccggtggttaaa
aacggacagattgttgttggaaataccatcaatctcaccctcgcttgcgatcaccgaacg
gtagatggcgcaacgggcgcacagttcttacaaaccttaaaaggctttattgaaaatcct
gtgacgatgttggtttaa

DBGET integrated database retrieval system