KEGG   Formosa sp. Hel1_33_131: FORMB_22370Help
Entry
FORMB_22370       CDS       T04465                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00010  Glycolysis / Gluconeogenesis
for00030  Pentose phosphate pathway
for00051  Fructose and mannose metabolism
for00052  Galactose metabolism
for00680  Methane metabolism
for01100  Metabolic pathways
for01110  Biosynthesis of secondary metabolites
for01120  Microbial metabolism in diverse environments
for01130  Biosynthesis of antibiotics
for01200  Carbon metabolism
for01230  Biosynthesis of amino acids
for03018  RNA degradation
Module
for_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FORMB_22370
   00030 Pentose phosphate pathway
    FORMB_22370
   00051 Fructose and mannose metabolism
    FORMB_22370
   00052 Galactose metabolism
    FORMB_22370
  09102 Energy metabolism
   00680 Methane metabolism
    FORMB_22370
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FORMB_22370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:for01009]
    FORMB_22370
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:for03019]
    FORMB_22370
Enzymes [BR:for01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FORMB_22370
Protein phosphatases and associated proteins [BR:for01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FORMB_22370
Messenger RNA biogenesis [BR:for03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FORMB_22370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AOR29255
UniProt: A0A1D7Y142
LinkDB All DBs
Position
2312588..2313574
Genome map
AA seq 328 aa AA seqDB search
MENQIKKIGVLTSGGDAPGMNAAIRSVARACAYHNIECVGIYRGYEGMIEGDFKSLNARS
VNHIINKGGTFLKSARSEEFRTKEGRKKAYDQLQKEQIDALVLIGGDGTFTGGMIFNEEF
NFPIIGIPGTIDNDIVGTNYTLGYDTALNTAVEAIDKIRDTASSHRRLFFVEVMGRDVGH
IALNAGVGSGAEEILVPEEDLGLDRLLESLEKSRHTGKSSSIVVVAEGDKTGKNVFELRD
YVEENLEGYDVRVSVLGHMQRGGSPSCFDRVLACRMGVKAVESLLEGKFNYMVGTVNNKL
ELYPIDKAVKGHSTIDAELLRVSDIMSI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcagataaaaaaaattggtgtattaacttccggaggcgatgcccctgggatg
aatgcagccatacgatctgttgcacgtgcctgtgcctatcacaacattgaatgtgttggg
atttacagaggctatgaaggaatgatagaaggtgactttaaatctttaaatgcacgaagt
gtaaaccatatcattaacaaaggaggtacttttttaaagtctgcgcgttctgaagaattc
agaacaaaagaaggccgtaaaaaggcgtatgaccaacttcaaaaagaacaaattgatgcc
ttggtattaattggtggagatggaacgtttacgggtggtatgatttttaatgaagaattc
aacttccctattatagggattccgggtactattgataacgatattgttggaaccaactat
acactaggatacgatacagcacttaatactgcggtagaagcaattgataaaattcgagac
actgccagttcgcatagacgcttgttttttgtggaggttatggggcgcgatgtgggtcat
attgctttaaatgcaggagttggttctggagccgaagaaattttggtccctgaggaagat
ttaggactggatcgtcttttagaatctttagaaaaaagtagacatacagggaaatcgtct
agtatagttgtggttgctgaaggagataaaacaggtaaaaatgtttttgaactaagagat
tatgttgaagaaaatttagaaggttacgacgttcgtgtgtctgttttagggcacatgcaa
cgtggagggtcaccatcctgtttcgatagagtattggcctgtagaatgggcgtcaaagcc
gtggagtctttattggaaggtaaattcaattacatggttgggactgtcaacaataaatta
gaattatatcctattgacaaagcagtcaaaggacattcaacaatagatgctgagctttta
agagtttcagatatcatgagtatttaa

DBGET integrated database retrieval system