KEGG   Fusarium oxysporum: FOXG_00556Help
Entry
FOXG_00556        CDS       T04882                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fox  Fusarium oxysporum
Pathway
fox00010  Glycolysis / Gluconeogenesis
fox00051  Fructose and mannose metabolism
fox00052  Galactose metabolism
fox00500  Starch and sucrose metabolism
fox00520  Amino sugar and nucleotide sugar metabolism
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
Module
fox_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fox_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FOXG_00556
   00051 Fructose and mannose metabolism
    FOXG_00556
   00052 Galactose metabolism
    FOXG_00556
   00500 Starch and sucrose metabolism
    FOXG_00556
   00520 Amino sugar and nucleotide sugar metabolism
    FOXG_00556
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FOXG_00556
Enzymes [BR:fox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FOXG_00556
Membrane trafficking [BR:fox04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FOXG_00556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 28942862
NCBI-ProteinID: XP_018232637
UniProt: A0A0J9WG85
LinkDB All DBs
Position
1
AA seq 509 aa AA seqDB search
MVGLGPRRPPSRKGSMADVPKDLADEIHKLEKLFTVEPAKLKEITDHFVSELAKGLSVEG
GSIPMNPTWVMSYPDGYETGTYLALDMGGTNLRVCQISLTEEKSEFDILQSKYRMPEELK
SGTSEELWEYIAECLYQFLETHHGDCSKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFD
IDGVEGKNIVPMFEEALKARGVPIKLAAIINDTTGTLIASAYTDTAMKIGCIFGTGCNAA
YMEDCGSIPKIADLNLPADLPMAINCEWGAFDNEHKVLPRTAYDVTIDKESPRPGQQAFE
KMIAGLYLGEIFRLILVDLHDNKAIHIFENQDIALLRKPYSLDASFLSAIEEYVFVLLGL
RTLLIVCFRDPWENLTETYDLFVKKLNLKPTRPELELVRRTAELIGTRAARLSACGVAAI
CKKKGYESCHVGADGSVFNKYPYFKERGAQALREILDWPVKTDKKAEDPIEVLTAEDGSG
VGAALIAALTLKRINEGNMAGILHPENFK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtctcggtcctcgacgtcctccctcccgaaagggatcaatggccgatgtccct
aaggatctcgccgatgagattcacaagctcgagaagctctttacggtagagcccgctaag
ctcaaggagatcaccgaccactttgtctccgaattggccaaaggcctcagtgttgagggg
ggtagcatccctatgaatcctacctgggtcatgtcataccccgatggctatgaaaccgga
acttacctggccctggatatgggcggaacaaacctgcgagtctgccagatcagcctgacc
gaagagaaatccgagttcgatatcctccagtccaagtaccgcatgcccgaggagctcaag
tctggtacatctgaagagctttgggaatacattgccgagtgtctttaccaattcctcgag
actcaccacggagactgcagcaagctggagaaaatccctctgggtttcacattttcatat
cctgccacccagaactacatcgatgagggtattctacagcgatggaccaagggcttcgac
attgatggtgtggagggcaagaacatcgtgcccatgtttgaggaggccctgaaggctcgc
ggcgtccccatcaagcttgcggctatcattaatgatactactggcacattgatcgcttca
gcctatactgataccgccatgaagatcggctgcatcttcggtacgggatgcaatgctgct
tacatggaagactgtggttccattcccaagattgccgacctaaatttgcccgctgatctg
cccatggccatcaactgcgagtggggagcttttgacaatgagcacaaggtccttccccga
actgcctacgatgtgactatcgataaggagtctcctcgccctggacaacaggccttcgaa
aagatgattgctggtctctacctcggcgagattttccgactcatcctcgtcgaccttcac
gataacaaggccatccatatctttgagaaccaggacattgctctgctacgcaagccttac
tccctcgatgcttccttcctgtctgctattgaagagtacgtttttgttttgctggggcta
cgcacactgctaattgtctgctttagggacccctgggagaacctgactgagacgtatgat
ctcttcgtcaagaagctgaatctgaagcccacacgtcccgaactggagctcgttcgaagg
accgccgagctcatcggcacacgtgctgctcgcctttcggcttgtggtgtcgctgctatc
tgcaagaagaagggttacgaatcttgccacgtcggtgctgatggctccgtgttcaacaag
tacccctacttcaaggagcgaggagctcaggctctgcgagagattctcgactggcctgtg
aagaccgacaagaaggctgaggaccctattgaggttcttactgccgaggacggcagtggt
gtcggcgccgccctgattgccgccctgacccttaagcgaatcaatgagggcaacatggcg
ggtatccttcatcccgagaacttcaaatag

DBGET integrated database retrieval system