KEGG   Fusarium oxysporum: FOXG_01544Help
Entry
FOXG_01544        CDS       T04882                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fox  Fusarium oxysporum
Pathway
fox00020  Citrate cycle (TCA cycle)
fox00190  Oxidative phosphorylation
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
Module
fox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fox_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOXG_01544
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FOXG_01544
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FOXG_01544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF600 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 28943787
NCBI-ProteinID: XP_018234324
UniProt: A0A0D2XCC1
LinkDB All DBs
Position
5
AA seq 650 aa AA seqDB search
MMASSMAMRRLAVGPAFTRAARFPSRAFSTTRPVARVITGNGPLRAKEASPFVSNKYAVI
DHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDD
WRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSK
QYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQDGECRGVLAYN
QEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPT
GIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVG
AEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYT
GEVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFNP
GDALKPVAADAASDHIEVLDKVRTADGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGVR
KMKEIDGMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTATSAANRKESRGAHAREDF
PERDDENWMKHTLSFQKEPHGKVDLAYRKVIANTLDEAECKPVPPFKRVY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcttctatggcaatgaggagattggccgtcggccctgctttcacgcgggct
gctaggttcccttctcgagctttctccaccactcgacctgttgcccgagttatcactggc
aatggtcctctgcgagctaaggaggcctctcctttcgtgagcaacaaatacgccgtcatc
gaccacgagtatgatgctctcgtcgttggtgctggtggtgccggtctgcgagctgctttc
ggtctcgctgaggctggcttcaacactgcctgtatctccaagcttttccctactcgatct
cacaccgtcgccgcccagggtggtatcaacgctgccctaggtaacatgcacgaggacgac
tggcgatggcacatgtacgataccgtcaagggttccgattggctgggtgaccaggatgct
attcactacatgacccgagaggctcctgcttccattatcgagcttgagaactacggctgc
cccttctcgcgaactgaggatggcaagatttaccagcgagctttcggtggtcaatccaag
cagtacggaaagggtggacaggcttaccgatgctgcgctgctgctgaccgaaccggccac
gcccttcttcacactctctacggacagtctctccgacacaagaccaactacttcatcgag
tacttcgccctcgacctgattatgcaggatggtgagtgccgaggtgtcctggcctacaac
caggaggacggcaccctgcaccgattccttgccaaccacactgttctcgctactggtgga
tacggccgagcctacttctcttgcacatctgcccacacctgtaccggtgacggtatggcc
atggttgcccgtgccggtctccccaaccaggatcttgagttcgttcagttccaccctacc
ggtatctacggagctggttgcctgatcactgagggttctcgtggtgagggtggttacctc
ctcaactctgagggtgagcgattcatggagcgatatgcccccaccgccaaggatcttgcc
tctcgtgatgtcgtttctcgatccatgaccatggagatccgtgagggccgtggtgttggt
gctgagaaggatcacatctacctccagctcagccatctgcccgccgagattcttgctgag
cgtctgcccggtatctctgagaccgctggtatcttcgctggtgttgatgtccgcaagcag
cccattcccgttcttcctaccgtccactacaacatgggtggtattcctacacgatacact
ggtgaggttcttaccgttgacgagaagggtgaggacaaggttgtccctggtctgtacgct
tgtggtgaggccgcttgtgtgtctgtccacggtgctaaccgtctgggtgccaactctctt
ctcgatcttgttgtcttcggtcgtgccgtttcgcacaccattcgtgacaagttcaacccc
ggtgacgccctgaagcctgttgccgctgatgctgcttccgaccacatcgaggtcctcgac
aaggtccgaactgctgatggtcctaagagcaccgctgagatccgacttgccatgcagaag
gctatgcagactgatgtcagcgttttccgaacccaggagagtttggacgagggtgttcgc
aagatgaaggagattgatggcatgtacagccaggttggcatgaaggatcgcagcatgatc
tggaactctgatctcgttgagactctcgagctccgcaacttgctcacctgcgctatccaa
actgccacctctgccgccaaccgaaaggagtctcgtggtgctcacgcccgcgaggatttc
cccgaacgagatgacgagaactggatgaagcacaccctttctttccagaaggagcctcac
ggcaaggtcgacctggcctaccgaaaggtcatcgccaacaccctggacgaggccgagtgc
aagcccgtgccacccttcaagcgtgtgtactaa

DBGET integrated database retrieval system