KEGG   Fusarium oxysporum: FOXG_01762Help
Entry
FOXG_01762        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
fox  Fusarium oxysporum
Brite
KEGG Orthology (KO) [BR:fox00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fox03400]
    FOXG_01762
Enzymes [BR:fox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     FOXG_01762
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     FOXG_01762
DNA repair and recombination proteins [BR:fox03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     FOXG_01762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC RHH_1
Motif
Other DBs
NCBI-GeneID: 28944003
NCBI-ProteinID: XP_018234735
UniProt: A0A0D2XCY7
LinkDB All DBs
Position
5
AA seq 854 aa AA seqDB search
MDAFVTRLSKPPSQLREQVRGDSPEKERPSKRAKRQGSPDSEGGLCPDHPQDISPREDFP
DNEAAKTKYQTEEHPRITGIESALPPAAEGQEAVEQYETMKSSQASAHDEDDTTETTQPL
WVKGRSSIYVDAFNLALDTVLEEESHLFDGKETEVFKQWRGLNYEAQYLYVRLFLRKTAS
WHRHSRLGYHNDISDLEAAITTLQSSRVLPASTATPIQSPVHGLELEESRLDETFSFADR
SQDHFDSVEEAASLLSLDELKELTKEAKVQGRNKSELIRSLVKMSKQQSGLMSVGLSRHN
SRGSVSEDQENLDAKAKRKDTAKLRREDSNREQHFLTKILAILGPCIRLSPPAFKLFERV
HLVFYRSTEWTEKSLTTIILAKIARRHFPEYIVCRTSTIFMSRLHLLEYETAIRMEAEVD
AWEFSSPPGDEGLRLMVNIFEKVYPRWKILVEEEQHKEHTVYEMGEGAYLRRFTPGHSYT
RIVHKAAPVFGKLKQHLREHELLTELLDQRLFHPARRGSWYQRKALLEEHYMPALDPNPK
FTDPEQQKKHWKKIAVATCEAGLQDPDCHLIFHYDLQKRLVKLEKKLRIPRRLQHDFGHV
DLQKPIEHTIKGIQLKKDIIAKGGRQVSTKTIWLDELDTQEECSVEAMCLSQYRSEGWKG
YHAEGGIIRTLFAYLFYDILFIYIPNVFQTAYQTCPLDLHTDAFYPSRASEINHRLVEIA
NGEAPRLIRKVWESEHERRTSVVGLNWDFEIDDLVELAGCFEGSALAAVCKVMAQEYRQR
GGGIPDLILWRTNNLPEDSNKVPGRPKGEVMFSEVKSANDRLSDTQRLWIHVLTGAGVKV
ALCNAIAKEVREVD
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgttcgtgacgaggctttccaagccgccgagccagcttcgagagcaagttcgc
ggtgactcaccagaaaaggagaggccttccaagcgagccaaacggcagggatcgccagac
tctgagggtggcctatgccccgatcacccccaggatatctcaccgagggaggattttcct
gacaatgaagcagctaaaacaaaataccaaactgaggaacaccctcgaattacgggtatt
gagagcgcgttgccgcccgctgctgaaggccaagaagcagtcgagcagtatgagacgatg
aagtcatcacaggcctcggcgcatgacgaggatgacaccacagaaacaactcagccactt
tgggtcaagggacgaagctctatttatgtagatgccttcaatcttgcgcttgatactgtc
ctagaagaagaatcacatttatttgatgggaaagagaccgaggttttcaaacaatggaga
gggctgaactacgaggctcaatatctctacgtcaggctctttctgaggaaaactgcatcg
tggcatcgccatagccgtcttggatatcacaacgacatttcggaccttgaggcagcgata
actaccctgcaatcgtctcgtgttctgccagcgagcacagccaccccaatacagagccca
gttcatggtcttgaacttgaagagtcgagactggatgagacgttcagctttgccgatagg
tcacaagatcattttgattctgtagaagaggctgcgtcgctgctgagcctagacgagttg
aaagagcttactaaggaagcaaaggtccaagggcgcaataaatcagaactcattcgttca
ctagtaaagatgagcaagcaacagtctggattgatgtcggtgggcctcagcagacacaac
agccgtggttctgtttccgaagaccaggaaaacttggatgcaaaagccaagagaaaggac
accgcgaagcttcggcgagaagattcgaatcgagagcagcatttccttacaaaaattctc
gcaatacttggaccttgcattcgattgtcgccaccagccttcaagctttttgaacgggtg
catcttgtgttctatcgatcgacggagtggacagagaaatcacttacaacaattattctt
gctaaaattgcaagacgtcattttcctgaatacattgtgtgccgaacttcgactatattt
atgtcgcgcctgcacctactagagtatgaaactgccatccgcatggaggccgaagtcgat
gcatgggagttcagtagcccacccggagatgagggcctcagactgatggtcaacatcttt
gagaaagtttacccgcgatggaagatattggttgaagaagagcagcacaaggagcacaca
gtctatgaaatgggagagggtgcttacttgagacgtttcacgccaggccattcgtataca
agaattgtccataaagcagcaccagtttttggaaagctcaaacaacatctcagagagcat
gagctgctcaccgagcttctcgatcaacggctattccatcctgcaagacgaggtagttgg
taccaacgaaaggctcttctggaggagcattatatgccagctttggacccaaatcccaaa
ttcacagaccccgaacagcagaagaaacattggaagaaaatcgcagttgctacttgtgag
gctggcctacaagacccggactgccatctgatatttcactatgacctgcaaaaacgcctt
gtcaagttagaaaagaaactacgtataccacgtcgcttacaacacgattttggccatgtt
gatctgcaaaaacctatcgaacacaccattaaaggaattcaactcaagaaggatatcatt
gcgaagggcggtcgccaagtttcaaccaaaactatatggctcgatgagctagacacccaa
gaggagtgtagcgttgaagcaatgtgtctcagtcaatatcgatcagagggttggaagggg
tatcacgctgagggtggaattattcgcactcttttcgcgtacctcttttacgatattctc
tttatctatattccaaatgtgtttcagacagcatatcaaacatgtccgctggatcttcac
actgatgctttctacccgtcccgagcatcagaaatcaaccacagactggtcgagattgcc
aatggagaggctccacgactcattcgcaaagtctgggaatcagaacatgagaggagaaca
agtgtggtgggccttaactgggatttcgagattgacgacctcgtagagcttgctgggtgc
ttcgagggaagcgctcttgcagcagtatgcaaggtgatggctcaagagtacagacaacga
ggcggcggtatcccggatctaattctgtggcgcactaataatctaccagaagattcaaac
aaggtgcctggaaggccaaagggagaggttatgttctcggaagtcaagagcgccaacgac
cggctgagtgatactcaacggctatggatccatgtgcttactggagcaggggtaaaggtt
gcgctctgcaacgccatagcgaaggaagtgagggaagtggattga

DBGET integrated database retrieval system