KEGG   Fusarium oxysporum: FOXG_02003Help
Entry
FOXG_02003        CDS       T04882                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fox  Fusarium oxysporum
Pathway
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Module
fox_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOXG_02003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fox01003]
    FOXG_02003
Enzymes [BR:fox01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     FOXG_02003
Glycosyltransferases [BR:fox01003]
 Polysaccharide
  Storage polysaccharide
   FOXG_02003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 28944227
NCBI-ProteinID: XP_018235223
UniProt: A0A0D2XDM3
LinkDB All DBs
Position
5
AA seq 705 aa AA seqDB search
MSEGEQQTRDIKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEEMEPTSPEIAATLQSMRDRGIHIVYGRWLIEGAPRVILIDTKTAYGRMDEWKADL
WEAASIPSPPGDDETNEAIVFGYLVAWFLGEFVCHEKKRAVIAHFHEWLAGVALPLCKKR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHACDV
FTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHFYG
HYDFDPDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKAAGSKVTVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTTHVIEQSIGRRIFERSLKWHEGDPMPDEKELISAQDRVLLRR
RLFAMKRHGLPPIVTHNMLNDHEDPVLNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLP
LDYDDFVRGCHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRTKGVDDSVNQLTSFMYDFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPNSFSGDDEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGL
STEDYVAWKLPEEEDPDEYPFPLTLRTKQPAPHSPSDNVPVNGTQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggcgagcagcagactcgcgacatcaagaaccaccttctctttgagattgcc
actgaggtagctcatcgagtcggtggtatctactcggttatcaaatccaaggctcctgtt
acaacagctgaatatggcgaccgctacacactgatcggtcccctcaaccatcaatcggcc
gccgtcgaggtggaggagatggaacccaccagcccagagatcgctgctaccctacagtcc
atgagagatcgaggaattcacattgtttatggtcgttggttgattgaaggggctcccaga
gttattctcattgacaccaagaccgcctatggtcgcatggatgagtggaaggccgatttg
tgggaagctgccagcattccttcaccacctggcgacgatgagaccaacgaggccattgtt
tttggttatctggtcgcctggttcctgggagagttcgtctgccatgagaagaagagggct
gtcattgctcacttccacgagtggcttgctggcgttgccctgcccctctgcaagaagcgc
cgcatcgatgtgacgacgatctttaccacacacgccactcttctcggccgatacctctgc
gctggctccgtggatttctacaacaacctgcaatggttcgatgtcgatgctgaggctggt
aagcgcggtatctaccaccgatactgcattgaacgagcagccgcgcatgcatgtgatgtt
ttcaccacagtctcccacatcacagcgtttgagtccgagcatctgctgaagcgaaagcct
gatggcgttctgcccaatggtctgaacgtcacaaagttctcggcggttcacgaattccaa
aacctgcatcagcaggcaaaggagaagattcatgactttgttcgagggcacttctatggt
cactacgactttgatcccgacaacactctatacctcttcaccgccggtcgttacgagttc
aggaataagggtgtcgacatgttcattgagtccctagcacgattgaaccatcgtctcaag
gccgctggtagcaaggtgaccgttgttgcctttattatcatgcctgctcagaccacttcc
ctcactgtcgaggcgctgaagggtcaagcggttatcaagtcactccgagataccacacac
gttattgagcaaagcattggccgtcgcatctttgagcgctctcttaagtggcatgagggt
gatcccatgcccgatgagaaggaactcatctctgctcaagaccgagttttacttcgccgt
cgtctctttgccatgaagcgtcacggacttcccccaattgtcacccataatatgctcaac
gatcatgaggatcctgtcctgaaccagattcgacgtgtacaacttttcaaccacccgtct
gaccgagtcaaggtagtcttccacccagagttcctcaactctgccaaccctgttcttccc
ctcgattacgacgactttgtccgaggttgtcacctgggcgtcttctcttcgtactatgag
ccttggggctatactcccgccgaatgtactgtcatgggtgtgcccagcattaccactaac
ctttcaggtttcggatgctatatggaagagcttatcgagaactcgagcgactatggtatc
tacattgtggatcgacgaaccaagggtgttgacgactcagtcaaccagctcacctcgttc
atgtacgatttttgcggcaagagccgccgtcagcgcatcaaccaacgaaaccgaacagag
cgtcttagcgacctccttgactggaagcgcatgggcatggagtatgtcaaggctcgtcag
ctagctctacgccgtgcctaccccaactctttcagtggcgacgatgaggaggaggacttc
atccctggtgtcgagcaaaagatttcgcgacccttctctgttcccggctcgccacgagat
cgcactggcatgatgacccccggcgattttgccagtcttcaggaaggccgtgaaggcctg
agcactgaggactatgttgcatggaagcttcctgaggaagaagaccccgacgagtaccca
ttccccctcactcttcgaacgaagcaacctgccccccatagcccttctgataatgtacct
gtcaacggaacccagtag

DBGET integrated database retrieval system