KEGG   Fusarium oxysporum: FOXG_03067Help
Entry
FOXG_03067        CDS       T04882                                 

Definition
(RefSeq) AGC/PKA protein kinase
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fox  Fusarium oxysporum
Pathway
fox04113  Meiosis - yeast
fox04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:fox00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    FOXG_03067
  09143 Cell growth and death
   04113 Meiosis - yeast
    FOXG_03067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fox01001]
    FOXG_03067
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fox03019]
    FOXG_03067
   03036 Chromosome and associated proteins [BR:fox03036]
    FOXG_03067
Enzymes [BR:fox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     FOXG_03067
Protein kinases [BR:fox01001]
 Serine/threonine kinases: AGC group
  PKA family
   FOXG_03067
Messenger RNA biogenesis [BR:fox03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     FOXG_03067
Chromosome and associated proteins [BR:fox03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    FOXG_03067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Pkinase_fungal Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 28945214
NCBI-ProteinID: XP_018236883
UniProt: A0A0D2XGM4
LinkDB All DBs
Position
8
AA seq 392 aa AA seqDB search
MAATVAPSHAGGLPSSSGIPAPSHSANSHSHAQDAPSGPTSPTPSPLPQTRKFNLRDFRR
VRTLGTGTFARVCLVRPAATAHIPLDHQLNPEVYALKILRKPEVIRLKQVDHVRHERAIL
ADVAGHPFITNLIASFSDQDSLYMLLDYVPGGELFTYLRKLRRFEESVARFYAAEIVLVL
EYLHEQQGGIAYRDLKPENLLLDQEGHIKLVDFGFAKRLGYREDNRPVETYTLCGTPEYL
APEVIQNKGHTGAVDWWALGILIYEFLTGYPPFWHQNPIEIYKQILEKPVVFPQDPPLSE
EAKDIIRSFCTVDRSRRLGNISGGAARVKSHPFFHDTNWDDIFNRRQKGPIQPPIRYPGD
AQCFDVYPEDDGSREPYGREMAEKYDPYFADF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaccgttgcgccctcacatgctggtggcctaccatcgtcatcgggaatccct
gcgccctcgcattccgcaaactctcactcacatgcccaagatgctccgagtggaccaaca
tctcccaccccaagtccattaccacaaacccgcaaattcaatcttcgcgacttcagacga
gttcgcacactagggacaggaacatttgctcgggtctgcctcgtccgtcccgccgcaact
gcgcatatcccccttgaccatcaactcaaccccgaagtctacgccctcaagatcctacgg
aaaccagaagtcatccgtctcaaacaagtcgatcatgtccgacacgaacgcgctattctc
gctgatgttgcaggtcatcctttcatcacaaacctaatcgcctccttttccgaccaagat
tcgctctacatgctgctcgactacgttcctgggggagagttgttcacatatcttagaaag
ttacgacgcttcgaagaatctgtcgcacgcttctacgccgccgagattgttcttgttctg
gagtacttgcatgagcagcaaggaggtattgcctatcgagaccttaaacctgaaaacctg
cttctggatcaagagggccacatcaagcttgttgattttggctttgccaagcgacttggc
taccgtgaagataaccgccctgtcgagacatacaccttgtgcgggacacctgagtatctc
gcccccgaggtcatccaaaacaaaggtcacacaggcgcagttgactggtgggcactgggc
attctaatatatgaattcttgacggggtatcctcctttctggcaccagaaccccatcgag
atctacaagcagatactagaaaagcccgttgtctttccccaagacccccccttatcagaa
gaagctaaggatataatacggtccttctgcaccgtcgatcgttctcggcgccttggtaat
ataagcggcggtgcagcacgtgtgaaatcccaccctttcttccatgacaccaactgggat
gacattttcaaccgtcgacaaaagggccccatccagcccccgatacgatatccgggcgat
gcacaatgtttcgacgtctaccccgaggacgacggatctcgcgagccttatggccgtgag
atggcggagaaatatgacccatatttcgctgacttctaa

DBGET integrated database retrieval system