KEGG   Fusarium oxysporum: FOXG_03076Help
Entry
FOXG_03076        CDS       T04882                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fox  Fusarium oxysporum
Pathway
fox04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:fox00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    FOXG_03076
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FOXG_03076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 28945223
NCBI-ProteinID: XP_018236901
UniProt: A0A0J9UL32
LinkDB All DBs
Position
8
AA seq 154 aa AA seqDB search
MVKAVSVLRGDSKVSGTVIFEQESESAPTTITWDITGNDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPHNKTHGAPSDETRHVGDLGNLETDGQGNAKGSVTDSLIKLIGPHSIIGRTVVV
HAGTDDLGKGDNEESLKTGNAGPRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtgagcgttctccgcggtgactctaaggtctccggcaccgtcatcttc
gagcaggagtccgaatctgcccctaccaccatcacctgggacatcaccggtaacgatccc
aacgccaaacgaggattccacatccacaccttcggtgataacaccaacggatgcacttcc
gctggtcctcacttcaaccctcacaacaagacccacggtgctccctctgacgagacccgt
cacgttggagacctcggaaacctggagaccgatggccagggaaatgctaagggctctgtc
accgactctcttatcaagctgattggcccgcacagcatcatcggtcgaaccgtcgttgtc
cacgccggcaccgacgatctcggcaagggtgataacgaggagtccctcaagactggtaac
gctggtccccgacctgcttgcggtgtcatcggaatctccaactaa

DBGET integrated database retrieval system