KEGG   Fusarium oxysporum: FOXG_04264Help
Entry
FOXG_04264        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
Organism
fox  Fusarium oxysporum
SSDB OrthologParalogGFIT
Motif
Pfam: p450 EKR
Motif
Other DBs
NCBI-GeneID: 28946320
NCBI-ProteinID: XP_018238895
UniProt: A0A0J9UNL8
LinkDB All DBs
Position
4
AA seq 442 aa AA seqDB search
MLYQFRDRVYQIKATEGVQVIVPARLVGELKGLPEDILSATEAVSDALQSKYTKFSPGHN
GELLALLVRTKLTQNLTRVVPLLKKELEHLLATEFPVCEDWTPVKWQPFSLRAVARLSGR
AFVGPSINRDEKWMDTSINFAVHVFTACVKLQFIPEWARPVGQHLVSELRQIRKDIKIAK
EMLKPILEERLRDMEFSNGGNAPDDMIQWLIEALPEEEKADLTTQAELQLIIAAASIHTT
NNLLCECLCDLAAYPEVQEELREEAYRVLEVDNGWENKESMAKLKKLDSFMREVQRLSGN
ITSFIRKVMKPISLSDGTELPVGTKVLAPQAGIALDERYFPDPERFDAFRFYKLRQESAE
ASNRWQFTSLNDTYINFGAGKHACPGRFFASNEIKLVLAHLLINYDIRLKAGEDRPKAMS
VVMAKAPSPDTELEFRRRSWAA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctgtaccagtttcgagatcgagtttaccagatcaaggctactgagggagtacaagtc
atagtacctgcccgtctcgttggtgaactcaagggactgccagaagatatcctcagtgca
acagaagccgtgtcagatgcacttcaaagcaagtacacaaaattctctccaggccacaac
ggtgaactactggcgctattggtcagaacaaaactcacacagaacctcacccgagtggta
cctcttctcaaaaaggaactggagcatctattagccactgagttcccagtctgcgaagac
tggacaccggtgaaatggcaacccttcagtcttcgtgccgtggcccgtctgagtggcaga
gccttcgttggaccatccatcaaccgagatgagaagtggatggacacttcgatcaacttt
gccgttcatgtctttacagcatgtgtcaagctccagttcatccctgagtgggctcgacct
gtgggccagcatcttgtctcagagcttcgtcagatccgcaaggatatcaagattgccaag
gaaatgctgaaaccaatccttgaagagcgactccgagatatggagttttccaacggagga
aatgcaccagacgacatgatccaatggcttattgaagcacttccagaggaggaaaaggcc
gatctcacaacccaggcagaactgcagttgattattgcagcggcttcaatccacacaacc
aataacctgctctgcgaatgcctttgcgacctagccgcatatcccgaagtacaggaagaa
cttcgagaagaggcgtatcgcgttctggaagtggacaatggatgggagaacaaggagagc
atggccaagctgaagaagctggacagtttcatgagggaggtccagcgtctcagtggaaac
attacatcattcattcgcaaggtcatgaagcccatctccctttccgatggcaccgaactg
ccagtaggcaccaaagtcctcgctcctcaagctggcatcgctctcgacgagcgctatttc
cccgaccccgaacgcttcgatgccttccgcttctacaagcttcgacaagaatcagcagaa
gccagtaatcgatggcaattcacatccctcaacgacacatatatcaatttcggcgcaggc
aagcatgcgtgcccgggccgtttctttgccagtaatgagatcaagcttgtgctggcacat
ctactcatcaactatgatatccgcttgaaagcgggcgaagatagaccaaaggccatgtcg
gtggtcatggctaaggctccttctccagataccgaactggagtttcgacgaagatcgtgg
gcagcttga

DBGET integrated database retrieval system