KEGG   Fusarium oxysporum: FOXG_05055Help
Entry
FOXG_05055        CDS       T04882                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fox  Fusarium oxysporum
Pathway
fox00020  Citrate cycle (TCA cycle)
fox00480  Glutathione metabolism
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
fox01210  2-Oxocarboxylic acid metabolism
fox01230  Biosynthesis of amino acids
fox04146  Peroxisome
Module
fox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fox_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOXG_05055
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOXG_05055
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FOXG_05055
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FOXG_05055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 28947058
NCBI-ProteinID: XP_018240028
UniProt: A0A0D2XM79
LinkDB All DBs
Position
7
AA seq 462 aa AA seqDB search
MPAAVFASSIQRSLLSSSLRRVAITSSAVRPVRASFGAIQTISPFAVRTMASHQKIKVKN
PVVELDGDEMTRIIWQVIKDKLILPYLDIDLKYYDLGLEYRDETNDQVTIDAAEAIKKYS
VGVKCATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKPI
IIGRHAFGDQYRAKDAVLPGPGKLSMVYTPEGGQPQEIEVFQFKNGGGVAQTQYNTDESI
TGFAHASFKLALDKELPLYMSTKNTILKKYDGRFKDIFQEIYESTYKKDFEAKKIWYEHR
LIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAH
GTVTRHYREHQKGNETSTNPIASIFAWTRGLVQRGKLDDTPEVVAFAESLEQACIDTVDI
DGIMTKDLALATGKSERKDYVTTNEYMDAVERRLKRTLKEKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgctgtcttcgcctcttccattcagcgatctcttctctcgtcttcgctgcgc
cgtgtcgctatcacttcatccgccgtccgccctgtccgagcttccttcggtgctatccaa
accatctctcccttcgccgtccgcacaatggcttctcaccagaagatcaaggtcaagaac
cccgtcgtcgagctcgacggtgatgagatgacccgcatcatctggcaggtcatcaaggat
aagctcatccttccttacctcgacatcgacctcaagtactatgatcttggtcttgagtac
cgtgatgagaccaacgatcaggtcaccatcgatgccgccgaggctatcaagaagtactcc
gtcggtgtcaagtgtgccaccatcacccccgatgaggctcgtgtcgaggagttcaagctg
aagcagatgtggctttcccccaacggaaccatccgaaatgcccttggtggtaccgtcttc
cgtgagcccattgtcatcccccgcattccccgtcttgttcctggctggaagaagcctatc
atcattggccgtcacgcctttggtgaccagtaccgcgccaaggacgctgtcctgcccggc
cccggtaagctctccatggtttacacccccgagggtggccagcctcaagagattgaggtc
ttccagttcaagaacggcggcggtgtcgctcagacccagtacaacaccgacgagtccatc
actggtttcgctcacgcttccttcaagctggctcttgacaaggagcttcctctctacatg
agcaccaagaacaccatcctcaagaagtatgatggtcgattcaaggatatcttccaggag
atctacgagtccacctacaagaaggacttcgaggccaagaagatctggtacgagcaccgt
ctcattgacgacatggtcgcccagatgatcaagagctccggtggttacatcatggccctc
aagaactacgacggtgatgtccagtccgacattgtcgctcagggcttcggctctcttggt
ctcatgacctctgttctcattacccctgatggcaagaccttcgagtctgaggctgcccac
ggtactgtcactcgccactaccgtgagcaccagaagggtaacgagacctccaccaacccc
attgcctccatcttcgcctggacccgtggtctcgtccagcgtggcaagctcgacgacacc
cccgaggttgtcgcctttgctgagagccttgagcaggcttgcattgacactgtcgatatt
gacggtatcatgaccaaggatcttgcccttgccactggcaagtctgagcgcaaggactat
gtcaccaccaatgagtacatggatgccgttgagcgccgtctcaagcgaaccctcaaggag
aagctgtaa

DBGET integrated database retrieval system