KEGG   Fusarium oxysporum: FOXG_08068Help
Entry
FOXG_08068        CDS       T04882                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fox  Fusarium oxysporum
Pathway
fox03030  DNA replication
fox03410  Base excision repair
fox03420  Nucleotide excision repair
fox03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fox00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FOXG_08068
   03410 Base excision repair
    FOXG_08068
   03420 Nucleotide excision repair
    FOXG_08068
   03430 Mismatch repair
    FOXG_08068
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fox03032]
    FOXG_08068
   03400 DNA repair and recombination proteins [BR:fox03400]
    FOXG_08068
Enzymes [BR:fox01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FOXG_08068
    6.5.1.6  DNA ligase (ATP or NAD+)
     FOXG_08068
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     FOXG_08068
DNA replication proteins [BR:fox03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    FOXG_08068
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     FOXG_08068
DNA repair and recombination proteins [BR:fox03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     FOXG_08068
   NER (nucleotide excision repair)
    Other NER factors
     FOXG_08068
   MMR (mismatch excision repair)
    Other MMR factors
     FOXG_08068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 28949721
NCBI-ProteinID: XP_018243996
UniProt: A0A0D2XVQ6
LinkDB All DBs
Position
4
AA seq 880 aa AA seqDB search
MPSPTKKRKLNNGTKSSTPARGLEYFFSKQKQNDTDSSKNPKTEENAEGTSSDATTELTD
EELARKLQAEWDQEVANTPQNTLQAQTIELPSKHNESVSRDETPSPAGPEPKPPVTLPTA
LNKPGTLTSTKPTLSLQAAGMAEDTTTTSIPLDESPLTFDPSEYLDQLKEHWASEGGNAS
YALLTRCFILINGTTSRIKIVDTLVNCLRVLIEGDPTSLLPAVWLATNAISPPYISMELG
LGGSAISKALRNVCGLDNRALKAIYDKFGDAGDVAFEAKKKQSFTLRKPKPLTIKGVYET
LVKIANSQGQGSSETKQRLVDRLLQDARGGEESRFVVRTLSQHLRIGAVKTTMLIALSRA
FLLSRPPGADFPLKSVSDLAKLKKEDLAEIWGRAEEIVKACFARRPNYNDLVPVLLEIGI
SEELLIRCGLTMHIPLRPMLGSITRDLSEMLTKLQGRDFACEFKYDGQRAQIHCDESGEV
SIFSRHLEVMTDKYPDLVELIPEIRGEGVDSFIMEGEVVAVDRETGELKNFQTLTNRARK
DVDIGSITVDVCMFAFDLMYLNGQPLLDRPFRERRELLRSLFTEIPHHFTWVQSLDATSA
DSESVLEFFKAATDIKCEGIMVKILDNLPTVPYTEEADDDGPDGTNKLLTPKSKSKGKGK
SKGKKDENGETKTKARRKPLLATYEPDKRLDSWLKVKKDYNSSFDTLDLIPVAGWHGQGR
KAKWWSPILMACRNEETGSLEAVCKCMSGFTDAFYKANRQFYDDGEENGEPKNTRTKQPA
FVEYSGPRPDIWFEPQEVWEMAFADITLSPTYTAAIGLASDERGLSLRFPRFMKKREDKS
LEEASTNDFLAGLWRKQEAKAETTKGETGAEAEEAEEADD
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtccaaccaagaaacggaagctcaacaacggcaccaaatcatcaacaccggcc
cgtggtcttgagtacttcttttcaaagcaaaagcagaatgacacagattcgagtaaaaat
ccaaagacagaagaaaacgctgaaggtacatcaagtgatgctactacagaattaacagac
gaggaattagctaggaagcttcaggcagaatgggaccaggaagttgccaacacaccacag
aacacactacaagcacagacaattgaactcccaagcaaacacaatgaatcagtctctcga
gatgaaactcctagccctgcaggcccagagccgaagcccccagtcaccctcccaacggct
ctcaacaagcctggtacactcacctctacaaaacctacactcagccttcaggcagcaggc
atggctgaagatacgactaccacatcgatacctctcgacgaatctcctctaacattcgac
ccatctgagtatctggaccaactgaaggagcactgggcatctgaaggcggcaatgcgtca
tatgcccttctcacacgctgcttcattctcattaacggcactacaagccggattaagatt
gtagatactcttgtaaactgcttaagagttcttattgagggagatccaacaagcttacta
ccagctgtatggttggcaacgaatgcaatttcacctccttatatctccatggaactcggg
ctgggtggctcagcaatatcaaaagcattgcggaacgtttgtggactagacaaccgagct
ttaaaggccatttacgacaaatttggagatgcgggagatgtggcttttgaagccaagaaa
aagcagagcttcactctcagaaaaccaaaacccctcacgatcaagggcgtctatgaaact
ttggtgaagattgccaacagtcaagggcagggcagttccgaaaccaagcaaagattggtt
gatcggttactgcaagacgctcgcggtggtgaagagagtcgatttgtcgtacggacactt
tctcagcatttgcgtattggtgctgtgaagacaacgatgctgatcgctttatcacgggcc
tttttgctctcacgcccaccaggggctgacttccctcttaaatcagtatctgatcttgca
aagctcaaaaaagaagatttggccgaaatttggggtcgggctgaggagatagtcaaggcc
tgctttgcgagacgcccgaactacaacgaccttgtgcccgttctcctggaaattggaatt
tccgaggaactactaatacgatgtggtcttaccatgcatataccgctacgacctatgctc
gggagcatcaccagagacctgtccgagatgctcacaaagctacagggccgagactttgcg
tgcgagttcaagtatgacggacagagagcgcaaatacattgtgatgagagtggagaagtc
agcatcttctcgcgtcatttggaggtcatgacagacaaatatcctgatctggttgagctg
atacctgagatacgcggagagggcgttgatagcttcatcatggaaggtgaagttgtcgca
gttgatcgtgaaaccggtgagctcaaaaattttcaaacgctcacaaatcgagcaagaaaa
gatgtcgatatcggaagtattactgtggacgtatgcatgtttgcgttcgacttgatgtat
ttgaacgggcaaccattgctagatcggccctttcgagaaagaagagagcttctgcgatca
ctcttcacagaaataccgcaccactttacttgggtacagagtcttgatgctacatctgcg
gactccgaatctgttctggagtttttcaaggcagccacggatatcaaatgcgagggtatc
atggtaaagatcttggataatttacccacagtgccatacacagaagaagcagatgacgat
gggccagatgggaccaacaaattgctaacaccaaagtctaagtccaaaggaaaaggaaaa
tcgaaaggaaagaaagacgaaaatggggagaccaaaacgaaagcaagacgtaaaccatta
ctggccacctacgagccagacaaacgacttgattcctggctcaaagtcaagaaagactat
aactcgagttttgatactctcgaccttattcctgtcgccgggtggcatgggcaaggacgt
aaggcgaaatggtggtcacctattctcatggcctgccgtaacgaagagaccggatccctg
gaggcagtatgcaaatgcatgtctggattcacagatgcattctacaaggccaatcggcaa
ttttacgacgatggcgaagagaacggcgaacccaagaacaccagaactaaacaacccgcc
ttcgtcgaatattcaggtccaagaccagatatctggttcgaaccacaagaagtgtgggaa
atggcatttgcagatatcacattgagcccgacttatactgcagcgattggtctcgcgagt
gatgagagaggactaagtttgagatttccaagatttatgaagaaacgggaggacaagagt
ctcgaagaggcgagcacgaacgatttcttggctggtctttggcgaaaacaagaagccaaa
gcggaaaccaccaagggtgagacaggggcagaagcagaagaggcggaagaagccgatgat
tga

DBGET integrated database retrieval system