KEGG   Fusarium oxysporum: FOXG_09250Help
Entry
FOXG_09250        CDS       T04882                                 

Definition
(RefSeq) histone deacetylase HOS3
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fox  Fusarium oxysporum
Brite
KEGG Orthology (KO) [BR:fox00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fox03036]
    FOXG_09250
Enzymes [BR:fox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FOXG_09250
Chromosome and associated proteins [BR:fox03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FOXG_09250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 28950828
NCBI-ProteinID: XP_018246366
UniProt: A0A0J9VBM1
LinkDB All DBs
Position
9
AA seq 1165 aa AA seqDB search
MASPNRPSLSVRRQSSARNLKQPEHDDLTQSLNQLSISTSPGRAPSRLSSEPASPFRPSG
RRTSQSPAPNARALSRSPSRSREASRDTPTLLRKASMNSLRSSNGIGPGSTPSRRSSVVH
HISPTQAKSPLSSTPPVLEKPRPTAISIAHDNLSDELQAHHGATSTRPTQMIVLLNDAVY
GHRFSRPRTSRAALSTIVERPERIKAAVLGISAAYVRLGGRHSEGEYPLHPKREAEDIHG
IPFRIQKTERRLSLLSPAVVNVHGTKWMEELKMMCDAAESKLAMGGKELQRPQMNRGAEK
ADKFHEGDLYLCSESLNAMEGALGAVCEAIDTVFGPGPQRAFVGVRPPGHHCSASYPSGF
CWVNNVHVGIMHAALNHGLTHAAIIDFDLHHGDGSQAITWQHNSRGNNAAKNAAAWKKSS
IGYFSLHDINSYPCEMGDEEKVRSASICIDNAHGQTVWNVHLEPWKSEEEFWKLYETRYI
VLLDKVRNYLRNQAERLRESNLPPKAAIFFSAGFDASEWESAGMQRHKVNVPTEFYARIA
QDVVKLAAEEGLHVDGRVISVLEGGYSDRALCSGILSHLSGLAGDQTYAQEPDNVGRLGV
EMGQKIGSLSGETSYSFEQKPSLDSVHAYDPSWWSPSLLDELEALMEVPNGPAKKPQSAT
LPTYFSPTQASTAKVSDPIKMRRSLSNLGASMTRPPSPPPPEVPWAIAAHELSKLLIPSS
RQTDSCKPEELNAEASKARRDRQSIIMGIDPNPPAISSSRPTSRMSLRERRAKAAPPDPT
TEKAPTSRRRTMGAAPISSDKAVARGIPSRTNSGEPAVRRTSRRLSEIPPSLTTRDVSPG
EADQPEVVEHARTVPNSPMATKSVASTNPPVKKARNSTAPRKEPAPRAPRGTKKATTTAG
PSRPATATQKAKSPAKASKKDGASGTGGDDIDSITSGMKKIRINLITQSQKDAKERARLE
AEKAKGKESSITYKPATASSGTEHSSSAASHDQTSISASVETQDISPTQPAPSNARIPSS
PTTASSSRIMSPSQEQYAFESTAQVTQLMSPPLSSPAIPSVSVHPSTDADDIFVPYQPEG
PAPEPVAQSEPLKWLPPNVPTPSEQTPVATPSPAKKSNLFQYTSGIPFAPRPGQGANEPK
AAEQGVKPEPNPPNPIEEIPETPQH
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccaaaccgcccatcgctgtcggttcggcggcagtcttccgcacggaacctc
aaacagcccgaacatgacgacttgactcagtctttgaaccaactctctatctccacctcg
cccggccgagctccgtcccgcctctcctccgaaccagcgtctcccttccgcccatcgggt
cgtcgcacttcacagtcgcccgcaccaaatgctcgagctctgtcccgtagcccgtcccgg
agccgcgaagcttctcgggacacacccacactactacgaaaggcgtctatgaattcgttg
cgctcctctaatggtatcggccccggttcgaccccttcgagacgttctagcgtggtgcat
catatatcaccaactcaggccaagtcgcctctatcatctactcctcctgtgctggagaaa
cctcgaccaactgcgatttccattgcacatgacaatctgagcgacgagctgcaggcgcat
catggcgcaacatccactcgcccaacccagatgatcgtattgctaaatgatgccgtctat
ggacatcgcttctcccgaccccgaacttctcgtgccgctcttagtactatcgtcgaacgt
ccagaaagaattaaggctgccgtgttgggtatatctgcagcgtatgtccgcctgggtgga
agacactctgaaggcgaatacccacttcacccaaagagagaggctgaggatatccatggc
attccattccggatacagaagacggaacgtagactttctctcttgtcaccagctgtagtt
aatgtgcatgggacaaaatggatggaagagctcaagatgatgtgtgatgcagccgaatcg
aaacttgcaatggggggaaaggaactacagaggccacagatgaacagaggggctgagaaa
gctgacaagttccacgaaggcgatctctacctttgctcagagtctctgaacgccatggaa
ggtgctctgggagctgtttgcgaagccatcgacactgtttttggtcccggacctcagcgg
gccttcgttggcgtgcgacctcccggtcatcattgttccgcctcctatccttcgggcttc
tgctgggtcaacaatgttcatgttggtatcatgcatgcggctctgaaccatgggctcacg
catgctgctatcattgactttgatcttcaccatggtgatggttctcaagctattacatgg
cagcacaattctcgaggaaacaatgctgccaagaatgcggcagcatggaagaagtcttca
attggctacttcagcttgcacgacatcaactcgtatccgtgtgaaatgggcgacgaagaa
aaggttaggagcgccagtatctgtatcgacaatgcacacggacagacagtttggaatgtc
catctggagccttggaagtccgaggaggaattctggaaactctacgagaccaggtatatt
gtgctcttggacaaggttagaaactatctcaggaaccaggcggagcgattaagagaatca
aacttgcctccaaaggctgccatcttcttctctgctggctttgatgccagtgaatgggag
agcgcaggaatgcagcgtcacaaggtcaacgtgccgacagagttttatgcccgtattgcc
caggatgtcgtcaaattggcggctgaagagggacttcacgttgatggtcgagttatcagc
gtgctagaaggcggctatagcgatcgagctttgtgctctggtatcctaagtcatctcagt
ggactcgctggagatcaaacttacgctcaagagccagacaatgttggccgtcttggtgtc
gaaatggggcagaagattggatccctttcaggagaaacgtcatacagtttcgagcaaaag
ccgtcattggactccgttcatgcttacgacccatcatggtggtcgccatcccttttggat
gagctcgaggctttgatggaggttccaaatggtccagccaagaagccacagagcgctacc
ctcccaacctacttctcaccaacacaggcatcaacggctaaggtctcagatcccatcaag
atgcgacgtagtttgtccaatttgggtgcgtctatgaccaggcctccatcaccacctccg
ccagaagttccttgggccattgcagcccatgagctcagcaagctcctgattccctctagt
cgtcaaaccgatagctgcaagcctgaggaactgaatgcagaggcaagtaaagcgagacga
gatcgccaatcaataatcatgggcattgacccaaaccctcctgctatctcttcttcgcgt
ccaacttctcgcatgtctttacgtgagagacgagccaaggcagcacctcctgatccaact
actgaaaaggcacccacaagccgcagaagaacaatgggcgctgctcccatctcttcggac
aaggcggttgcgcgcggtattccctcgagaacgaatagcggtgaaccggcagtgaggagg
accagtcgtcgtcttagtgagatcccgccatccctcacaacaagagatgtatcaccaggc
gaagcagatcagcctgaggtggtggagcacgctcgtacagtccccaactcacccatggct
acgaaatctgttgccagcaccaatcctccagtcaagaaggcaaggaattctaccgcccct
cgcaaggagcctgcacccagagcacctcggggtaccaagaaagctactactaccgctggc
ccttcgcgacctgccacagctacacagaaagccaagtcgccagccaaggcttcgaagaag
gacggtgcatctggcacgggtggcgatgacattgacagtatcacctctggtatgaagaag
attcgtatcaacttgatcacccagtctcagaaggacgccaaagagcgagctcgccttgaa
gctgagaaagccaagggcaaagaatcttctatcacatacaagcctgccacagcatcttcc
ggtactgagcactcatcatcagccgctagccatgatcaaacctccatcagtgcttccgtc
gagacgcaagacatctctcctactcaacctgcaccgagcaatgcccgcatcccttcatcg
cctaccactgcctcttcgagcagaattatgtctccctcacaagagcaatacgcttttgaa
tccactgcgcaagtcactcagctgatgtctcctcccctgagttctcctgccatcccctct
gtttccgtacaccctagcacggatgcagatgatatctttgttccttaccaacccgaaggc
cctgcgcctgagcccgttgctcagagcgagcctttgaagtggcttccacctaacgtacca
actccatctgagcaaacgcctgtcgcgacacctagcccggccaagaagagcaatcttttc
caatacacttccggtattccatttgcccctcgcccgggacagggagccaatgagcccaag
gccgcagagcagggtgttaagccagagccaaacccgccgaatcctatcgaggagattccc
gagacgcctcagcattaa

DBGET integrated database retrieval system