KEGG   Fusarium oxysporum: FOXG_09278Help
Entry
FOXG_09278        CDS       T04882                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fox  Fusarium oxysporum
Pathway
fox00020  Citrate cycle (TCA cycle)
fox00190  Oxidative phosphorylation
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
Module
fox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fox_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOXG_09278
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FOXG_09278
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FOXG_09278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 28950854
NCBI-ProteinID: XP_018246409
UniProt: A0A0D2XZ56
LinkDB All DBs
Position
9
AA seq 278 aa AA seqDB search
MAALRSSSRLVGAFSRTAAFRPGAVFTRSMASVSEPPKDSDANLKSFQIYRWNPDTPSEK
PRLQTYTLDLNKTGPMILDALIRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLC
RIPTEAASDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAEDGKEYRQTKED
RRKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDERTAERKTNLEN
SMSLYRCHTILNCTRACPKGLNPGKAIAEIKKQMAFGN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcttcgatcttcttcccgacttgtcggagccttctcaagaacggctgctttc
cgacctggtgctgtcttcactcgttctatggcctcagtcagcgagcctcctaaagactct
gatgccaacctcaagtctttccaaatctaccgatggaaccccgatacccccagcgagaag
cctcgtcttcagacctacactctggacctcaacaagactggacctatgattcttgatgcc
ctcatccgaatcaagaacgagctcgaccctactctgaccttccgacgaagttgccgtgag
ggtatctgcggtagctgcgctatgaacatcaacggacagaacactcttgcttgcttgtgc
cgaattcccactgaggctgcttccgacgtcaagatctaccctcttcctcacacctatgtc
gtcaaggaccttgtccctgatttgacacatttctacaagcagtacaagagcattaagccc
taccttcagcgcgatacccctgctgaagacggcaaggagtaccgacagactaaggaggac
cgccgtaagctcgatggtctctacgagtgcattctctgcgcctgctgctctacctcatgc
ccatcttactggtggaactctgaggagtaccttggccccgctatccttctccagtcttac
cgatggctcgccgactctcgtgacgagcgcaccgccgagcgaaagaccaacctcgagaac
tcgatgagcctgtaccgttgccacaccattcttaactgtacacgagcctgtcccaagggt
cttaaccctggcaaggccattgccgagatcaagaagcagatggctttcggcaactag

DBGET integrated database retrieval system