KEGG   Fusarium oxysporum: FOXG_11134Help
Entry
FOXG_11134        CDS       T04882                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fox  Fusarium oxysporum
Pathway
fox00250  Alanine, aspartate and glutamate metabolism
fox00410  beta-Alanine metabolism
fox00430  Taurine and hypotaurine metabolism
fox00650  Butanoate metabolism
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
Module
fox_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FOXG_11134
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FOXG_11134
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FOXG_11134
   00430 Taurine and hypotaurine metabolism
    FOXG_11134
Enzymes [BR:fox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FOXG_11134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 28952559
NCBI-ProteinID: XP_018249157
UniProt: A0A0D2Y4D1
LinkDB All DBs
Position
1
AA seq 578 aa AA seqDB search
MSLVQHSESEAASPVPIIETDDQGRPVKTSTNGYFPSNGQHLPSSANGAVTSSFIDNMSH
LSVVRARDDSDAASVRSTSSRTSRKPQMQLASYQDEFTTSVYGSRFAGMDLPRHHMPENE
MPRDIAYRMIKDDLSLDNNPMLNLASFVTTYMEDEAEKLMAESFSKNFIDYEEYPQSADI
QNRCVNMIGDLFHAPPGESVGTSTVGSSEAIMLAVLAMKKRWKNRRQAEGKSTEHPNIVM
SSAVQVCWEKATRYFEIDEKLVYCTPDRFVMDPDEAVDLCDENTIGMCAILGTTYTGEYE
DIKAINDLLVERNLDVPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHKYGLVYP
GVGWVIWRSPEYLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKHGYRAI
MSNLTRTADYLTETLENLGFVIMSERSGAGLPLVAFRFKTVEEGGDPDRHYDEFALAHHL
RSRGWVVPAYTMAPNSGVKMLRVVVREDFTKSRCDQLICDVKLCHGLLKETDQESIKKRE
EYIRNHISAMGRGKHSHPVYKDESHSLQGKTGKTHAIC
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgtacaacattcagaaagtgaggctgcctcacctgttcccatcatcgagaca
gacgaccaaggaagacctgtaaagacaagtacaaacggttatttcccctccaacggccaa
catcttccttcttctgccaacggagctgttacttcttcgttcatcgacaacatgtctcat
ctctccgttgtccgtgccagagacgactctgacgctgcgtctgttcgctccacgagctct
cgcacctcgagaaagcctcagatgcagcttgcgagctaccaggatgagttcaccaccagc
gtttacggctctcgctttgcgggcatggacctccccaggcatcatatgccagagaacgag
atgccccgcgacattgcctatcgcatgatcaaggatgatctgagtctcgacaacaacccc
atgctcaacttggcatcctttgtcactacttacatggaagatgaggccgaaaaactcatg
gcggagtccttctccaagaacttcatcgattacgaggagtaccctcaatccgccgatatt
cagaaccgctgtgtcaacatgatcggtgatctcttccacgcgcctcctggagaatcagtc
ggtacatctactgttggttcatcagaagccatcatgcttgctgtcttggccatgaagaag
cgctggaagaaccgcagacaggctgagggcaagagcacggagcaccccaacatcgtcatg
tcctctgctgtgcaggtctgttgggaaaaggctactcgatatttcgagattgacgagaag
ctcgtctactgcactcctgatcgattcgtcatggatcctgatgaggctgttgatctgtgc
gacgagaacaccattggcatgtgcgctattctcggaactacttacactggcgagtatgag
gatatcaaggccatcaacgatctcctcgtcgagcggaatctcgatgtgcccatccacgtc
gatgctgccagtggcggtttcgtcgcgcccttcgtggtccctgacctagaatgggatttc
cgatgtgaaaaggtcgtctctatcaatgtttcaggtcacaagtacggtcttgtgtatcct
ggtgttggttgggtcatctggcgatctcccgagtatctccctcaagagctcgtcttcaac
atcaactacctcggagccgatcaatcctctttcactcttaacttctccaagggtgcatca
caggtcattggtcagtactaccagctcatccgtctcggcaagcatggttaccgtgctatc
atgagcaatctcacccgtactgccgattacctcacagaaacccttgagaacttgggtttc
gtcatcatgtcagaacgatctggagctggtctccccctcgttgccttccgcttcaagact
gttgaagagggcggtgatcctgatcgccactacgatgagtttgctctcgctcaccacctc
cgttctcgaggttgggtcgtccccgcttacaccatggctcccaactctggtgtcaagatg
ttgcgtgttgttgtccgagaggacttcacaaagagtcgatgtgaccagctcatctgcgat
gtcaagctgtgccacggtcttctcaaggaaacagatcaggagtccatcaagaagcgtgag
gaatacatcaggaatcacatttctgccatgggtcgtggaaagcattcccaccctgtttac
aaggacgagtcacattctctccagggcaagactggcaagacacatgctatttgctag

DBGET integrated database retrieval system