KEGG   Fusarium oxysporum: FOXG_11417Help
Entry
FOXG_11417        CDS       T04882                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fox  Fusarium oxysporum
Pathway
fox00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOXG_11417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fox02000]
    FOXG_11417
Enzymes [BR:fox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FOXG_11417
Transporters [BR:fox02000]
 Other Transporters
  Pores ion channels [TC:1]
   FOXG_11417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 28952820
NCBI-ProteinID: XP_018249609
UniProt: A0A0J9VK17
LinkDB All DBs
Position
10
AA seq 308 aa AA seqDB search
MQQAYFLRALLSTSSRETRFINIRTRSIMTNVDTSLPPEPTGAAAKFAAQHAEEHPLKLY
GGWFCPFVQRTWITIHEKKIPHQYVEINPYKKEAHFMAMNPRGLVPTLAVPVDPKGKVQK
PLFESNIICEYLDEAFTDDSKYGPRLLPTDPYERARCRIWIDHISTRIIPSWYKLMQHTP
DKPFSLDEAREELRGRIKSLVEEMDPEGPWFLGSTLSLVDVCLAPWAKRLFLIDHYKEGG
HGIPESGEGKDGEIWKRWKKWYDAILNRDSVKETWSADDRYIIAYKRYAEDTTNSEVGQA
TRSGKRLP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcctatttcttgcgagctctgctttcaacttcatcaagagaaacaagattc
ataaatattagaactagatccatcatgacaaacgtcgacacttctctacctccagaacca
actggcgcagccgctaagtttgctgctcagcatgctgaagagcatccgctgaagctctac
ggaggctggttctgccctttcgtccaacgaacttggatcactattcacgaaaagaagatt
cctcatcaatatgtagagatcaacccatacaagaaagaggctcacttcatggccatgaat
ccccgtggattggtccctactcttgcagtacccgttgacccgaagggcaaggtgcagaag
cctctgtttgagagcaacatcatttgtgaatatctcgatgaggcgttcacggacgattct
aagtatgggcctcgacttcttcctaccgatccatatgagagggcaagatgtcgtatttgg
atcgatcatatcagcacacgcatcattccctcatggtacaagctcatgcagcacactccc
gacaagccttttagccttgatgaggcaagagaagaactgagaggacgaatcaagtctcta
gttgaggagatggaccctgaaggcccatggtttctcggctcgactctgagtctcgtggat
gtttgcttagcaccatgggcgaagcgcctgttcttaattgatcactacaaggagggcggc
catggtatcccggagtctggcgaaggtaaagatggggagatttggaagaggtggaagaag
tggtatgatgcaattctcaaccgtgatagtgtgaaggagacctggagtgcagatgaccga
tacatcattgcgtataagagatatgccgaggatactaccaactctgaagttggtcaggct
acgcgttcgggcaagcgtcttccttga

DBGET integrated database retrieval system