KEGG   Fusarium oxysporum: FOXG_11482Help
Entry
FOXG_11482        CDS       T04882                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fox  Fusarium oxysporum
Pathway
fox00730  Thiamine metabolism
fox00790  Folate biosynthesis
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FOXG_11482
   00790 Folate biosynthesis
    FOXG_11482
Enzymes [BR:fox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FOXG_11482
Exosome [BR:fox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FOXG_11482
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fox00537]
 Enzymes
  FOXG_11482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 28952885
NCBI-ProteinID: XP_018249700
UniProt: A0A0J9VLS7
LinkDB All DBs
Position
10
AA seq 562 aa AA seqDB search
MPSPQANESDPLLSGSGDGRSDAQADKAARNSRLRELGLFAWALIATAAVIVVAIWTQHE
QQTKHDHNTPASKRNLVFMVSDGMGPAPLSLTRSFRQHVEELPFGDTLTLDKHFWGTSRT
RSSSSLVTDSAAGATAFSCGKKTYNGAISTLPSHDPCGTVLEAAKRAGYHTGLVVTTKIE
DATPACFNSHVVLREMEDEIALQQIGEGVLGRTVDLMLGGGRCNFLPNSTEGSCRADDTD
VIKIAKEKHNWTYTDSRAGFDALKGGNNVKLPFLGLFAPTDIPFEIDRRNHNDVYPSLSE
MAKTALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFQAVLDFIK
ESKTETVLVATSDHETGGLATAIQEPGHLPVYNWYPKALANATASAEWLHAKLNTHLASD
SSIKKNKEKLKKYINEELIVRGLGISNASDKEITTIADHPESALVLFSALISLRAHVGWS
THGHTAVDVNIYSSGGPGTESIRGNVENTDVGKYLREYLEVDVDAITSELKEKMSKVNVQ
DVGMEGLDEVWSLGNKYHAIEV
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgccttctcctcaggccaacgaaagcgatcctctcttgtccggctccggtgacggccgc
tccgatgctcaggccgataaggccgcccggaactcgcgactccgtgaactcggcctcttt
gcctgggctctgattgccactgctgctgtcattgttgttgctatctggactcagcatgag
caacaaaccaagcatgatcacaacacgcccgcttctaagcgaaacctcgtcttcatggtg
tcagacggcatgggccctgcacctttgtccttgacgcgtagcttccgacaacacgtggaa
gagcttcccttcggcgataccctcactctcgataagcatttctggggcacgagccggact
cgctccagcagttccctggttacagacagcgctgccggtgctacagccttctcctgtggc
aagaagacctacaatggtgctatctctacactccctagccacgatccttgtggaacagtc
ctagaagctgccaagcgtgctggatatcatactggacttgttgtcacaacaaagattgag
gatgcgactccagcctgcttcaactcccacgtggtcctccgcgagatggaagacgagatt
gctcttcaacagatcggagaaggtgtcctgggccgaactgttgatctgatgcttggtggt
ggtcgctgcaacttcttgcccaacagcacagagggcagctgccgagccgacgacacggat
gtgatcaagattgcaaaggaaaagcacaactggacctacaccgacagtcgcgctggcttt
gacgctctcaagggtggcaacaacgtcaagctgcctttcctcggactctttgccccaact
gacatcccctttgagattgaccgccgaaaccacaacgacgtctacccctcgctgagcgaa
atggccaagactgctcttcgcgctcttgagaaggctaccgagaagagtgacaagggcttc
ttcatcatgatcgagggtagccgaattgaccatgccggtcatatcaacgatcctgcagct
caggtccacgaggttcttgagtatgacaagacattccaagctgttcttgatttcatcaag
gaaagcaagactgaaactgttcttgtcgcaaccagcgatcatgaaactggtggtcttgcc
actgcgattcaggaacccggtcacctccctgtctacaactggtaccccaaggccctcgcg
aatgctaccgcctcggctgagtggcttcacgccaagctcaacacacacctcgcctctgat
tccagcatcaagaagaataaggagaagctaaagaagtacattaacgaggaactcatcgtc
cgcggtcttggtatctccaatgcctctgacaaggagatcaccaccattgccgatcaccct
gagagcgcccttgtcctcttctcagctctcatctccctgcgcgcccacgtcggttggagt
acccacggccacactgccgtcgacgtcaatatctacagttctggtggcccgggaacagag
agcatccgtggtaatgttgagaacaccgatgttggcaaatatctacgggagtatcttgag
gttgacgttgacgcgatcacctcggaactcaaggaaaagatgagcaaggttaatgtccaa
gatgttggcatggaaggactcgatgaagtttggtctctcggcaacaagtaccatgctatt
gaggtctaa

DBGET integrated database retrieval system