KEGG   Fusarium oxysporum: FOXG_13566Help
Entry
FOXG_13566        CDS       T04882                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fox  Fusarium oxysporum
Pathway
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOXG_13566
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FOXG_13566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 Kelch_2
Motif
Other DBs
NCBI-GeneID: 28954822
NCBI-ProteinID: XP_018252838
UniProt: A0A0D2YB88
LinkDB All DBs
Position
12
AA seq 582 aa AA seqDB search
MFTQILYGLTALSALQGQVTASPGGSSLDRFISKEADISIKGVLANIGADGKRAQGAAPG
AVVASPSRTDPDYWYTWTRDSALTYKVLVERFIHGDKSLQRKVDEYVSAQAKLQGVTNPS
GGPETGGLGEPKFHVNLTAFTGSWGRPQRDGPPLRATALTLYANWLVSHGDRSKAINKVW
PVIEKDLAYTVKFWNRTGYDLWEEVNGSSFFTLSASHRALVEGAALAKKLGKSCSDCAAN
APRILCFMQSFWTGSYIDSNINVNDGRKGLDANSILSSIHTFDPSSKCTDSTFQPCSSRA
LANHKAVVDSFRSIYGVNKNRGKGKAAAVGRYSEDVYYDGNPWYLATLAAAEQLYAAVYQ
WNKIGSITVDSASLSFFSDLVPKVSKGTYRKNSKTYKAIVKAVTSYADGFVAVVQSYTPK
DGSLAEQFDKSTGTPKSAVHLTWSYASFVGAAERRTGVVPPSWGESGANKVPAVCEAAPA
CDTTITFNVKNIDVTSDQKVYIVGGITQLSNWAPADGIALEASTSTKGLWTVKVNIPSDT
SFEYKYIKKTSDGTVTWESDPNNSAATGSKCGSSSTINDEWR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtttactcagatcttgtatggcctcacggccttgtccgccctccaaggccaggtcact
gcatcgcccggcggttctagcctcgatcgcttcatctccaaagaggccgacatctccatc
aagggcgtccttgccaatattggcgccgatggcaagcgagctcagggcgctgcacctggt
gccgttgtagcaagtccatcgcgaacagacccagactactggtacacatggacccgagat
tccgcgttgacgtacaaagtcctggttgagcgcttcatccacggagacaagtctcttcaa
cgcaaggtcgacgaatacgtctctgcccaagccaaactccagggcgtcaccaacccatcc
ggtggtcccgagactggcggtcttggcgagcccaagttccacgtcaacctcacagcattc
acaggatcttggggtcgccctcaacgcgatggtcctcctctgagagctactgcattgact
ctgtacgcaaactggcttgtttctcatggcgaccgctccaaggccatcaacaaggtctgg
cccgtcattgagaaggatcttgcatacaccgtcaagttctggaacagaaccggttatgat
ctttgggaggaggtcaacggatcttcgttcttcaccctctctgcttctcatcgtgctctc
gtcgagggagccgctcttgctaaaaagcttggcaagtcttgctccgactgcgcagccaac
gcccctcgtattctgtgctttatgcaaagcttctggaccggcagctacatcgactcgaac
atcaacgttaacgatggccgcaagggtcttgatgccaactctattctctcgtcaattcac
acctttgatccttcctccaaatgcactgactcaaccttccagccttgttcatcaagggct
cttgcgaaccataaggcagtagtggactctttccgatctatctatggtgtcaacaagaac
agaggtaaaggaaaggccgccgccgtcggtcgatacagtgaggatgtgtattacgatggc
aacccttggtatcttgctactcttgctgctgccgagcaactgtatgctgctgtctaccag
tggaacaagattggttctatcactgttgatagcgcgtcgctttctttcttcagtgacctc
gtacccaaggtttccaagggtacctatcgcaagaacagcaagacatacaaagctatcgtc
aaggctgtcacttcatatgctgatggcttcgtcgctgttgtgcaaagctatacccccaag
gatggctcactcgccgagcagttcgataagtcgactggaactcccaagtcagctgttcat
ctcacctggtcctacgcttcctttgtcggtgccgccgagcgtcgcacgggtgtcgttcct
ccaagttggggcgaaagcggcgccaacaaggttcccgctgtttgcgaagctgctcccgcc
tgtgacaccaccatcaccttcaatgtgaagaacattgatgtgacgtctgatcagaaggtt
tacattgttggcggaatcactcaactttccaactgggctcctgctgacggcattgcactt
gaggcatccacgagcaccaagggcttgtggacggtgaaggtcaatattccctctgatacc
agctttgagtataagtacatcaagaagacgagtgatgggactgttacctgggagagtgac
ccgaataacagtgctgcgacgggaagcaagtgcggaagcagcagtactatcaacgatgag
tggaggtag

DBGET integrated database retrieval system