KEGG   Fusarium oxysporum: FOXG_13932Help
Entry
FOXG_13932        CDS       T04882                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fox  Fusarium oxysporum
Pathway
fox00020  Citrate cycle (TCA cycle)
fox00310  Lysine degradation
fox00380  Tryptophan metabolism
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
Module
fox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOXG_13932
  09105 Amino acid metabolism
   00310 Lysine degradation
    FOXG_13932
   00380 Tryptophan metabolism
    FOXG_13932
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FOXG_13932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 28955156
NCBI-ProteinID: XP_018253382
UniProt: A0A0D2YCA1
LinkDB All DBs
Position
10
AA seq 1051 aa AA seqDB search
MLRNSLCRASSQLLRGARCSAASSTASISTLSARTSSWKLAASRRPLAVAARRNYATSAT
SAPPDPNDNFLSGSTASYIDEMYMQWRQDPESVHVSWQIYFKNMESGEMPISQAFQPPPN
LVPNMTGGVPRLAGNLAMEDGSDVTNHLKVQLLVRAYQSRGHHTAKIDPLGIRGTNDAKG
FSNIKPKELTLEHYGFTEKDMDTEYTLGPGILPRFKRDGREKMTLREIVDACERIYCGSF
GVEFIHIPDRDKCDWLRERLEVPTPFKYSVDEKRRVLDRLIWSSSFESFLATKYPNDKRF
GLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTNG
AEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEK
THRTAMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARST
AYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQ
PSFTQPLMYKRITEKEPQIDIYVNKLIEEGSFSKADVDEHKQWVWGMLEESFTKSKDYTP
TSKEWTTSAWNGFKSPKELATEVLATNETSVKSTTLEHIGTVIGSTPEGFHVHRNLKRIL
ANRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDT
YTPLQHLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIID
QFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRDFPTGEKLVRQH
QDCNMQIAYMTSPANLFHILRRQMHRQYRKPLVIFFSKSLLRHPLARSNIEEFTGENAGF
QWIIPDPEHETGAIKAPEEIERVILCSGQVWAALHKHRSENNLDNVAITRIEQLNPFPWQ
QLKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSAS
VATGLKQVHMKEERELLEMAFTVKQDKLKGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctctgtagagctagctcgcagctccttcgcggtgctcgatgctct
gctgcctcgtctaccgcctctatctcgaccctctcggcccgtacatcatcatggaagctc
gccgcctcccgccgccctctggccgttgctgctcgtcgcaactatgcgaccagcgcgact
tctgcgcctcccgatcctaacgataacttcctctccggaagcaccgctagctacatcgat
gagatgtacatgcagtggaggcaagatcctgagagcgtccatgtctcttggcagatctac
ttcaagaacatggagagcggcgagatgcccatctctcaagctttccagcctcctcctaac
ctggtccctaacatgaccggtggcgtccctcgccttgctggcaacctggccatggaggat
ggctcagatgtcaccaaccatctcaaggttcagcttcttgtccgcgcttaccagtctcgc
ggtcatcataccgccaagattgatcccctcggtatccgaggtacaaacgatgccaagggc
ttctccaacatcaagcccaaggaattgactcttgagcactatggtttcaccgagaaggac
atggacaccgagtacaccctcggccctggtatcctgcctcgcttcaagcgtgatggtcgt
gagaagatgactctccgtgagattgtcgatgcttgcgagagaatctactgcggttctttc
ggtgttgagtttattcatatccctgaccgtgacaagtgcgactggctccgtgaacgtctt
gaggtccctactcctttcaagtactctgtcgatgagaagcgccgtgttcttgaccgactt
atctggagttccagcttcgagtctttcctggccactaagtaccccaacgacaagcgattc
ggtctcgagggttgtgagacccttgtccctggtatgaaggctctcattgaccgcagtgtc
gactatggtgtcaaggacattgtcatcggtatgcctcaccgtggtcgtcttaatgttctc
tccaacgtcgtccgaaagcccaacgagtctattttcagcgagttcgctggtacaaacggt
gccgaggatgagggatctggtgacgtcaagtaccatcttggtatgaacttcgagcgtccc
actccctccggcaagcgtgttcagctttctctggtcgccaacccttcgcatctcgaggct
gaggatcccgtcgtcttgggcaagacccgcgctatccagcactacaacaacgatgagaag
actcaccgcaccgccatgagtgttctccttcacggtgatgccgcctttgctgcccagggt
atcgtctacgagtgtctcggcttccactctctccccgccttttctaccggtggtaccatt
cacctcgtcgtcaacaaccagattggtttcaccaccgatcctcgattcgcccgatctacc
gcctactgtaccgatattgccaaggccatcgacgctcctgttttccacgttaatgctgat
gatgtcgaggctgtcaactttgtctgccagcttgctgccgattggcgcgccgagttccag
cacgatgttgtcattgacctcaactgctaccgaaagtacggccacaacgagaccgaccag
ccttccttcacccaaccgctcatgtacaagcgcatcactgagaaggagcctcaaatcgac
atctacgtcaacaagctcatcgaggagggttctttctccaaggcggatgtcgatgagcac
aagcagtgggtctggggcatgctcgaggagagcttcaccaagtccaaggactacactcct
acctccaaggagtggaccacctctgcttggaacggtttcaagtctcccaaggaactggcc
accgaagttttggctactaacgagacaagtgtcaagagcaccactctcgagcatatcggt
accgttattggaagcactcccgagggcttccatgttcaccgcaacttgaagcgtattctc
gccaaccgaaccaagtctgttgtcgagggcaagaacatcgacttccctactgccgaggct
ctggcctttggttctctcgttactgagggttaccacgtccgtgtctccggtcaggatgtc
gagcgtggcaccttctctcagcgacacgctgtcttccacgaccaggagaccgaggatacc
tacactccccttcagcacctgagccaggatcagggcaagttcgtcatctctaactcttcc
ctaagtgagtttggtgctctgggctttgagtatggttactcgctgtcctcaccccacgcc
cttgtcatgtgggaggcccagttcggtgactttgccaacaacgctcaatgtatcatcgac
cagtttatcgcttctggtgaggtcaagtggatgcagcgaaccggtcttgtcatgtctctg
ccccacggttacgatggtcagggtcccgagcactcttctggacgtctcgagcgatacctt
cagctcagcaacgaggatccccgtgatttccccactggtgagaagcttgtccgtcaacac
caggactgcaacatgcagatcgcctacatgacctctcctgccaacttgttccatattctc
cgccgccagatgcaccgccagtaccgcaagcccctcgttatcttcttctccaaatctctt
ctccgtcaccctctggctcgtagcaacattgaggagttcactggcgagaacgctggcttc
cagtggattatccctgatcccgagcatgagactggtgctatcaaggctcctgaggagatt
gagcgcgttattctctgcagcggtcaggtctgggctgcccttcacaagcaccgatctgag
aacaacttggacaatgtcgccatcactcgcattgagcagcttaaccccttcccttggcaa
caactcaaggagaaccttgaccaataccccaacgccaagaccatcgtctggtgccaggag
gagcctctcaacgccggtgcctggagcttcactcagccccgtatcgagactctgctcaac
aacactgagcaccacacccgcaagcacgtcatgtacgctggccgaaaccctagtgcttcc
gtcgccactggtctcaagcaggttcacatgaaggaggagcgcgaactcctcgagatggct
ttcactgttaaacaggacaagctcaagggcgagtaa

DBGET integrated database retrieval system