KEGG   Fusarium oxysporum: FOXG_16582Help
Entry
FOXG_16582        CDS       T04882                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fox  Fusarium oxysporum
Pathway
fox00052  Galactose metabolism
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FOXG_16582
   00500 Starch and sucrose metabolism
    FOXG_16582
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FOXG_16582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 28957431
NCBI-ProteinID: XP_018257201
UniProt: A0A0J9W9H8
LinkDB All DBs
Position
11
AA seq 1026 aa AA seqDB search
MTTVTAGFLYGVSLALFLSGGVSADLEGSMHHDETIQSHHAKNESVYITKHDGLMVFLAQ
QPALLISIMFFKTLLTSAVAFGTAFAQSKAGVEDLDKPRRDLFEKDLSKCPGYKATNHRE
TKSGFYADLSLAGQACDVFGIDLPELKLEVEYQTEDRLHVKILDTNNTVYQVPDDIFPRP
GYGQWASPKNSKLKFDFKADPFSFTVTRKDSGEVLFDTSGSKLVFESQYLYLKTKLPERP
YLYGLGEHSDPFMLNATNYTRTIYTRDAYGCPNGQNLYGAHPIYFDHRKGGTHGVFLLNS
NGMDVFIDKKNGKQFLEYNIIGGVLDFYFIAGPTPRDVAKQYAEITTLPLMTPYWGLGFH
QCRYGYRDVYEVAGVVANYSAAKIPLETMWTDIDYMDRRRIFTIDPERFPADKYKDLVDT
IHARDQHYIVMVDPAVYDMEPNPALTSGLQYDTFMKEPNGSDYRGVVWAGPSVFPDWFNP
NSQQYWNELFQNFFDGEHGPNIDALWIDMNEPANFFNRPYPGNNTTPENFAKVDGDPPKA
PPVRDGPPARIPGFPESLQPPSLRSTKREVATVAKTTKRSVEVRTTPRNRGVGRWAATRK
VWGQNKYGRPGQGWQNGKKTGSGCGPDECKGLPNRELIQPPYMIQNGAGPTLADSTTDTD
LVQSGDYVQYDTHNLYGAQMSSHSHNAMRARRPDKRALVITRSTFAGSGKDVSHWLGDNL
SQWDQYRFSISQILQFASIYQIPVVGADVCGFGGNVTETLCARWATLGSFYTFFRNHADI
TSQSQEFYRWPKVTEAARNGISIRYQLLDYIYTAIYKQNQTGTPTLNPMFFNYPKDKNTY
SIDLQFFYGDGILVSPVTKENSTKLEYYLPDDIFYEWSTGKPVRGKAQYESAEVDVTDIM
VHYKGGLIYPQRVESANTTKALRQKGFNLVIAPGLDGKAEGSLYLDDGESVVQDTASEID
FKYNKGKLSFDGTFEYDAGVGIETITVLGVKSQPKGTDHAEYDAKNKKLVFTADIPLTRK
CHVDLF
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgttacagcgggttttctgtacggagtctccctcgctctgttcctgagcggc
ggagtctccgccgacctggaaggtagcatgcatcatgacgagacgattcaaagtcaccat
gccaagaacgaatctgtatatataaccaagcatgatggcttgatggtttttcttgctcag
caaccagctcttctcatttcaatcatgttcttcaagacgctgctcacttcagccgttgcc
tttggcactgcttttgcgcagagcaaggctggcgttgaagacctcgacaaaccccgcaga
gacctcttcgagaaggatctctctaaatgtcccggctacaaagctaccaaccaccgggag
acgaagtcaggcttctacgctgacttgtctcttgcgggacaggcctgcgatgtctttggc
attgatctccccgagctgaagctcgaggttgagtatcagactgaggaccgtcttcacgtc
aagatcttggatacgaataacaccgtctaccaagtacctgatgatatcttccctcgtcct
ggctatggacagtgggcttcgcctaagaactcgaagctcaaatttgacttcaaggcggat
cctttctcgttcactgtgacgaggaaggattctggggaagtgctttttgacacttcaggt
agcaagcttgtttttgagagtcaatacttgtatctcaagacgaagcttcctgagaggcct
tatctttacggtcttggtgagcacagtgatcctttcatgctcaatgccaccaactacacc
cgcacaatctacactcgcgatgcttatggttgccccaatggacagaacctctatggagct
caccccatttactttgaccaccgcaagggcggcacccacggtgtcttcctcctcaattcc
aacggcatggatgtcttcatcgacaagaagaacggcaagcaattcctggagtacaacatc
attggcggtgttctcgacttctacttcatcgctggtcctacgccccgcgacgtcgccaag
cagtacgccgagatcaccacccttcctctcatgacgccctactggggtcttggtttccat
cagtgcagatatggataccgagatgtctacgaagtcgcaggcgtggtggccaattactct
gctgctaaaatcccgctcgagactatgtggactgacatcgactacatggaccgtcgtcgc
atcttcactatcgaccctgagagattccctgctgataagtacaaggatctcgttgacact
atccacgctcgcgatcagcactacatcgtcatggttgatccagctgtgtatgatatggag
cccaacccagctctcaccagcggtcttcagtacgatactttcatgaaggagcctaatggt
tcagactacagaggagttgtctgggctggacccagtgtcttccccgattggttcaacccg
aactctcagcagtactggaatgaactcttccagaacttcttcgacggcgagcatggtcct
aatatcgatgctctctggatcgatatgaacgagcccgccaacttcttcaaccgtccttat
cccggcaacaacaccactcccgagaacttcgccaaggtcgacggtgatcctcccaaggcc
cctcccgtccgagacggccctcctgctcgcatccccggattccctgagagtcttcagcca
ccctccctccgctccaccaagcgcgaagttgccactgtcgccaagaccaccaagcgctcc
gtcgaagtccgcaccactcctcgcaaccgcggtgttggtcgctgggcagctacccgcaag
gtctggggccagaacaagtacggtcgtcccggccaaggctggcaaaacggcaagaagact
ggctctggctgcggtcctgacgagtgcaagggtcttccaaaccgagagctcatccagcct
ccttacatgattcagaacggcgctggacctacactggctgacagtaccaccgacaccgat
ctcgttcagagtggagattacgttcagtatgatacgcacaacttgtatggtgctcagatg
tcttctcactctcacaacgctatgcgtgcgcgacgccctgacaagcgtgctctcgtcatc
acacgaagtacctttgctggttccggcaaggatgtttcgcactggcttggcgataacctg
tctcagtgggatcaataccgcttctccatctctcagatcctgcagttcgcttctatctac
cagattcccgttgtcggtgctgatgtctgtggatttggtggcaacgtcaccgagaccctt
tgtgctcgatgggctacccttggaagtttctatactttcttccgtaaccacgccgatatt
acttctcagtctcaggagttctaccgctggcccaaggttactgaggctgctcgcaatggt
atttccatccgataccagctccttgactacatctacactgccatctacaagcagaaccag
accggtactcctactctcaaccccatgttcttcaactaccccaaggacaagaacacctat
tccatcgatctccagttcttctatggtgatggtattctcgtcagccccgtcaccaaggag
aacagcaccaagctcgagtactacctccccgatgatatcttctacgagtggtccaccggc
aagcccgtccgcggtaaggctcagtacgagtccgccgaggttgacgtcaccgacatcatg
gtccactacaagggcggtcttatctacccccagcgcgttgagagcgccaacacaaccaag
gctctccgccagaagggtttcaacctcgtcatcgcccctggtcttgacggaaaggccgaa
ggttctctgtatcttgatgatggcgagtctgttgttcaggacactgcttctgagatcgac
ttcaagtacaacaagggcaagttgagcttcgatggaacttttgagtatgatgcgggtgtt
ggtattgagaccattactgttctgggcgtcaagtctcagcccaaaggtacggaccatgct
gagtatgatgctaagaacaagaagctcgtgtttactgcggatattccgttgacgcgcaag
tgtcacgttgacttgttctga

DBGET integrated database retrieval system